EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03201 - HMD)
FAM  PF03201
PID  HMD
DES  H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase
IPR  IPR004889
ANO  6
ALN  100
AID  0.438638
APH  (O26604_METTH/200-297:0.16482,(HMDX_METJA/194-291:0.28663,((HMD_METTL/243-340:0.26700,HMD_METTH/245-342:0.29776):0.06625,HMD_METKA/253-352:0.25703):1.10653):0.10713,HMDY_METJA/205-302:0.19771);
ATP  (O26604_METTH/200-297,(HMDX_METJA/194-291,((HMD_METTL/243-340,HMD_METTH/245-342),HMD_METKA/253-352)),HMDY_METJA/205-302);
ATL  2.72512
DNO  6
DLN  300
DID  0.498639
DPH  (HMDX_METJA/194-291:0.34151,(O26604_METTH/200-297:0.11218,((HMD_METTL/243-340:0.31405,HMD_METTH/245-342:0.25278):0.11954,HMD_METKA/253-352:0.23563):0.60557):0.23724,HMDY_METJA/205-302:0.12230);
DTP  (HMDX_METJA/194-291,(O26604_METTH/200-297,((HMD_METTL/243-340,HMD_METTH/245-342),HMD_METKA/253-352)),HMDY_METJA/205-302);
DTL  2.3408
RID  0.438638
RPH  (O26604_METTH/200-297:0.16482,(HMDX_METJA/194-291:0.28663,((HMD_METTL/243-340:0.26700,HMD_METTH/245-342:0.29776):0.06625,HMD_METKA/253-352:0.25703):1.10653):0.10713,HMDY_METJA/205-302:0.19771);
RTP  (O26604_METTH/200-297,(HMDX_METJA/194-291,((HMD_METTL/243-340,HMD_METTH/245-342),HMD_METKA/253-352)),HMDY_METJA/205-302);
RTL  2.72512
LNK  HMD_METKA/253-352:Q02394:X60719
LNK  HMD_METTH/245-342:O27211:U19363
LNK  HMD_METTL/243-340:Q50759:X92848
LNK  HMDX_METJA/194-291:Q58125:U67518
LNK  HMDY_METJA/205-302:Q58734:U67574
LNK  O26604_METTH/200-297:O26604:AE000834
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  HMDY_METJA/205-302
ASQ  ADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQ--KDLDAALEILQNL
DSQ  GCTGATGTTTCTTCAGTTGTTGCTGATATGGGGAGTTTAGTTACTGCAGTTGCTTTATCGGGAGTTCTGGACTACTATACAGTTGGAAGAAAGATTATAAATGCTCCTAAGAAGATGATTGAACAGCAAGTTATCATGACCCTACAGACAATGGCTTCTCTTGTTGAAACATCAGGTATTGAAGGGATGGTAAAGGCATTAAATCCAGAGTTATTAATAAGGAGTGCTTCATCAATGAAGTTATTAGATAGACAG------AAGGATTTAGATGCTGCCTTAGAGATTCTTCAAAACTTA
TRN  10010101100011000
NAM  O26604_METTH/200-297
ASQ  ADVTSAVADMGSLVTAVALAGVLDYYYVGTQIIKAPEEMVEKQILMTLQTMASLVETSGVDGMAAAINPELLVKSARSMHLLDEQ--EELDAALKKISDL
DSQ  GCAGATGTGACCTCAGCGGTGGCCGATATGGGGTCACTGGTCACAGCGGTGGCACTTGCAGGTGTACTGGACTACTACTATGTGGGTACACAGATCATAAAGGCCCCCGAGGAGATGGTTGAGAAGCAGATACTCATGACACTCCAGACAATGGCGTCCCTGGTTGAGACATCAGGTGTTGACGGGATGGCAGCCGCCATCAACCCTGAGCTGCTCGTAAAAAGTGCAAGGTCGATGCACCTGCTGGATGAGCAG------GAGGAACTCGACGCAGCCCTCAAGAAGATCTCAGACCTC
TRN  10010101100011001
NAM  HMDX_METJA/194-291
ASQ  ADVVPAVADMGALVTAVALVGVLDYYRVGTQIINAPKDMIEKQILISLQTIASIIETSGMEGLMKVFNKDALLSSAKNMLIDERQ--EDLNLALKIIEEF
DSQ  GCAGATGTTGTTCCTGCAGTTGCGGATATGGGGGCTTTAGTCACTGCAGTTGCCTTAGTTGGAGTTTTGGATTATTATAGGGTTGGAACGCAGATTATCAACGCTCCAAAGGATATGATAGAAAAGCAAATATTGATATCTTTACAAACAATTGCTTCAATTATTGAAACTTCTGGAATGGAGGGATTAATGAAAGTATTTAACAAAGACGCTTTACTTTCATCTGCAAAGAACATGTTAATTGATGAAAGACAG------GAGGATTTAAATTTAGCTTTAAAGATTATTGAAGAGTTT
TRN  10010101110011000
NAM  HMD_METTL/243-340
ASQ  ANLISPVCDMGSAVTAPVYAAVLAYRDAVTKILGAPADFAQMMADEAITQILELMRKEGINNMEKTLDPKALTGTADSMCFGPLS--DILPPALKVLEKH
DSQ  GCAAACTTAATTAGCCCAGTATGTGACATGGGTTCAGCTGTTACCGCACCAGTTTACGCTGCTGTCTTAGCTTACAGAGATGCAGTTACAAAAATTTTAGGAGCTCCTGCTGACTTCGCTCAAATGATGGCTGATGAAGCAATCACACAAATCTTAGAATTAATGAGAAAAGAAGGAATTAACAACATGGAAAAAACTTTAGATCCAAAAGCTTTGACCGGTACAGCAGACAGTATGTGCTTCGGTCCATTGTCA------GACATCCTTCCTCCAGCATTAAAAGTTCTTGAAAAGCAT
TRN  10010101110011000
NAM  HMD_METTH/245-342
ASQ  AELLGPVCDMCSALTAITYAGILSYRDSVTQVLGAPAGFAQMMAKESLEQITALMEKVGIDKMEEHLDPGALLGTADSMNFGASA--DILPTVFEILEKR
DSQ  GCCGAACTCCTCGGACCAGTATGTGACATGTGCTCAGCCCTCACAGCAATAACCTACGCAGGTATACTATCCTACAGGGACTCAGTCACACAGGTACTCGGCGCGCCCGCAGGTTTCGCACAGATGATGGCCAAGGAGTCACTTGAACAGATAACAGCCCTTATGGAAAAGGTTGGAATAGACAAGATGGAAGAGCACCTCGACCCCGGTGCACTTCTGGGTACAGCTGACTCCATGAACTTCGGAGCATCAGCA------GACATACTCCCAACCGTATTTGAAATCCTCGAGAAGAGG
TRN  10010101100011001
NAM  HMD_METKA/253-352
ASQ  GYLLGPVCDMASAVTAIVYAGLLTFRDACTDILGAPVDFTQNMAVEALQMMAKFMEEEGLDKLEEALDPAALTNTADSMNFGPLADTEILPKALEVLEKY
DSQ  GGCTACCTGCTGGGCCCGGTGTGCGACATGGCCAGCGCCGTCACGGCGATCGTGTACGCCGGCCTGCTGACGTTCCGAGATGCGTGTACCGACATCCTAGGAGCTCCCGTGGACTTCACCCAGAACATGGCCGTAGAAGCACTGCAGATGATGGCGAAGTTCATGGAGGAAGAGGGTCTAGACAAGCTAGAGGAGGCCCTGGACCCGGCGGCGCTCACGAACACGGCCGACTCGATGAACTTCGGCCCGCTGGCGGACACGGAGATCCTGCCGAAGGCCCTAGAGGTCCTGGAGAAGTAC
TRN  11011111101111111
//