EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03176 - MMPL)
FAM  PF03176
PID  MMPL
DES  MMPL family
IPR  IPR004869
ANO  37
ALN  116
AID  0.272679
APH  ((((((((((((MMPL1_MYCTU/128-239:0.44581,MMPL2_MYCTU/130-240:0.39944):0.10123,(Q50085_MYCLE/4-113:0.64268,(MMPL9_MYCTU/134-245:0.32545,MMPL5_MYCTU/139-250:0.20723):0.05417):0.05058):0.10051,(MMPL4_MYCLE/132-243:0.24558,MMPL4_MYCTU/135-246:0.09398):0.10452):0.05348,Q9XCF6_MYCAV/129-240:0.36650):0.13530,Q9XCF5_MYCAV/131-242:0.35225):0.18851,(Q9XB10_MYCBO/119-230:0.41315,MMPL7_MYCTU/150-261:0.97347):0.34860):0.15773,((MMPLA_STRCO/111-222:0.71150,MMPLD_STRCO/118-225:0.90083):0.19064,MMPLB_STRCO/126-235:0.92046):0.40424):0.09174,((((Q9XB10_MYCBO/698-812:1.12002,((MMPLA_MYCLE/768-882:0.11176,(MMPL8_MYCTU/803-917:0.32316,MMPLA_MYCTU/735-849:0.09338):0.08692):0.20805,MMPLC_MYCTU/756-870:0.26283):0.41227):0.21902,(MMPL9_MYCTU/702-816:0.19185,(((MMPL2_MYCTU/697-811:0.15991,MMPL6_MYCTU/124-238:0.11220):0.06556,((Q50086_MYCLE/127-241:0.20552,MMPL5_MYCTU/708-822:0.13808):0.07777,(Q9XCF5_MYCAV/701-815:0.22922,Q9XCF6_MYCAV/697-811:0.13370):0.06115):0.07393):0.05780,MMPL1_MYCTU/696-810:0.28062):0.08062):0.41801):0.36753,MMPLA_STRCO/452-559:0.75595):0.28909,(((Q9RKC1_STRCO/118-220:0.31065,Q9RL63_STRCO/118-220:0.54322):0.15766,P96687_BACSU/117-220:0.80578):0.26285,Q9Z577_STRCO/114-218:0.62375):0.96100):0.10293):0.20778,YDGH_BACSU/112-216:1.05235):0.39102,MMPLC_MYCTU/132-243:0.28234):0.25059,MMPL8_MYCTU/150-260:0.31920):0.09212,MMPLA_MYCTU/105-216:0.13663,MMPLA_MYCLE/131-245:0.14401);
ATP  ((((((((((((MMPL1_MYCTU/128-239,MMPL2_MYCTU/130-240),(Q50085_MYCLE/4-113,(MMPL9_MYCTU/134-245,MMPL5_MYCTU/139-250))),(MMPL4_MYCLE/132-243,MMPL4_MYCTU/135-246)),Q9XCF6_MYCAV/129-240),Q9XCF5_MYCAV/131-242),(Q9XB10_MYCBO/119-230,MMPL7_MYCTU/150-261)),((MMPLA_STRCO/111-222,MMPLD_STRCO/118-225),MMPLB_STRCO/126-235)),((((Q9XB10_MYCBO/698-812,((MMPLA_MYCLE/768-882,(MMPL8_MYCTU/803-917,MMPLA_MYCTU/735-849)),MMPLC_MYCTU/756-870)),(MMPL9_MYCTU/702-816,(((MMPL2_MYCTU/697-811,MMPL6_MYCTU/124-238),((Q50086_MYCLE/127-241,MMPL5_MYCTU/708-822),(Q9XCF5_MYCAV/701-815,Q9XCF6_MYCAV/697-811))),MMPL1_MYCTU/696-810))),MMPLA_STRCO/452-559),(((Q9RKC1_STRCO/118-220,Q9RL63_STRCO/118-220),P96687_BACSU/117-220),Q9Z577_STRCO/114-218))),YDGH_BACSU/112-216),MMPLC_MYCTU/132-243),MMPL8_MYCTU/150-260),MMPLA_MYCTU/105-216,MMPLA_MYCLE/131-245);
ATL  22.2255
DNO  37
DLN  348
DID  0.436827
DPH  ((((((((((((((MMPL5_MYCTU/139-250:0.19891,(((Q50085_MYCLE/4-113:0.38353,MMPL1_MYCTU/128-239:0.28907):0.04931,MMPL2_MYCTU/130-240:0.26762):0.07091,MMPL9_MYCTU/134-245:0.29085):0.05850):0.07602,(MMPL4_MYCLE/132-243:0.21846,MMPL4_MYCTU/135-246:0.13382):0.09685):0.04337,(Q9XCF6_MYCAV/129-240:0.21305,Q9XCF5_MYCAV/131-242:0.27697):0.07031):0.18933,(Q9XB10_MYCBO/119-230:0.29121,MMPL7_MYCTU/150-261:0.65141):0.21422):0.07290,(((MMPLA_MYCTU/105-216:0.17463,MMPLA_MYCLE/131-245:0.12923):0.07264,MMPL8_MYCTU/150-260:0.24093):0.16550,MMPLC_MYCTU/132-243:0.22578):0.22217):0.02074,(((Q9RKC1_STRCO/118-220:0.09670,P96687_BACSU/117-220:0.81806):0.14442,Q9RL63_STRCO/118-220:0.25307):0.15386,Q9Z577_STRCO/114-218:0.31083):0.28198):0.08816,((MMPLA_STRCO/111-222:0.31723,MMPLD_STRCO/118-225:0.41787):0.13155,MMPLB_STRCO/126-235:0.45592):0.08698):0.05191,YDGH_BACSU/112-216:0.75804):0.11163,MMPLA_STRCO/452-559:0.42538):0.12787,(MMPL9_MYCTU/702-816:0.23872,(((Q50086_MYCLE/127-241:0.20365,MMPL1_MYCTU/696-810:0.24617):0.05178,((Q9XCF5_MYCAV/701-815:0.17952,Q9XCF6_MYCAV/697-811:0.12261):0.06330,MMPL5_MYCTU/708-822:0.16286):0.04850):0.05086,(MMPL2_MYCTU/697-811:0.20254,MMPL6_MYCTU/124-238:0.10300):0.05425):0.03899):0.25229):0.10378,Q9XB10_MYCBO/698-812:0.66790):0.23008,MMPLC_MYCTU/756-870:0.23991):0.09244,MMPL8_MYCTU/803-917:0.25213):0.09823,MMPLA_MYCLE/768-882:0.20302,MMPLA_MYCTU/735-849:0.07544);
DTP  ((((((((((((((MMPL5_MYCTU/139-250,(((Q50085_MYCLE/4-113,MMPL1_MYCTU/128-239),MMPL2_MYCTU/130-240),MMPL9_MYCTU/134-245)),(MMPL4_MYCLE/132-243,MMPL4_MYCTU/135-246)),(Q9XCF6_MYCAV/129-240,Q9XCF5_MYCAV/131-242)),(Q9XB10_MYCBO/119-230,MMPL7_MYCTU/150-261)),(((MMPLA_MYCTU/105-216,MMPLA_MYCLE/131-245),MMPL8_MYCTU/150-260),MMPLC_MYCTU/132-243)),(((Q9RKC1_STRCO/118-220,P96687_BACSU/117-220),Q9RL63_STRCO/118-220),Q9Z577_STRCO/114-218)),((MMPLA_STRCO/111-222,MMPLD_STRCO/118-225),MMPLB_STRCO/126-235)),YDGH_BACSU/112-216),MMPLA_STRCO/452-559),(MMPL9_MYCTU/702-816,(((Q50086_MYCLE/127-241,MMPL1_MYCTU/696-810),((Q9XCF5_MYCAV/701-815,Q9XCF6_MYCAV/697-811),MMPL5_MYCTU/708-822)),(MMPL2_MYCTU/697-811,MMPL6_MYCTU/124-238)))),Q9XB10_MYCBO/698-812),MMPLC_MYCTU/756-870),MMPL8_MYCTU/803-917),MMPLA_MYCLE/768-882,MMPLA_MYCTU/735-849);
DTL  14.5139
RID  0.272679
RPH  ((((((((((((MMPL1_MYCTU/128-239:0.44581,MMPL2_MYCTU/130-240:0.39944):0.10123,(Q50085_MYCLE/4-113:0.64268,(MMPL9_MYCTU/134-245:0.32545,MMPL5_MYCTU/139-250:0.20723):0.05417):0.05058):0.10051,(MMPL4_MYCLE/132-243:0.24558,MMPL4_MYCTU/135-246:0.09398):0.10452):0.05348,Q9XCF6_MYCAV/129-240:0.36650):0.13530,Q9XCF5_MYCAV/131-242:0.35225):0.18851,(Q9XB10_MYCBO/119-230:0.41315,MMPL7_MYCTU/150-261:0.97347):0.34860):0.15773,((MMPLA_STRCO/111-222:0.71150,MMPLD_STRCO/118-225:0.90083):0.19064,MMPLB_STRCO/126-235:0.92046):0.40424):0.09174,((((Q9XB10_MYCBO/698-812:1.12002,((MMPLA_MYCLE/768-882:0.11176,(MMPL8_MYCTU/803-917:0.32316,MMPLA_MYCTU/735-849:0.09338):0.08692):0.20805,MMPLC_MYCTU/756-870:0.26283):0.41227):0.21902,(MMPL9_MYCTU/702-816:0.19185,(((MMPL2_MYCTU/697-811:0.15991,MMPL6_MYCTU/124-238:0.11220):0.06556,((Q50086_MYCLE/127-241:0.20552,MMPL5_MYCTU/708-822:0.13808):0.07777,(Q9XCF5_MYCAV/701-815:0.22922,Q9XCF6_MYCAV/697-811:0.13370):0.06115):0.07393):0.05780,MMPL1_MYCTU/696-810:0.28062):0.08062):0.41801):0.36753,MMPLA_STRCO/452-559:0.75595):0.28909,(((Q9RKC1_STRCO/118-220:0.31065,Q9RL63_STRCO/118-220:0.54322):0.15766,P96687_BACSU/117-220:0.80578):0.26285,Q9Z577_STRCO/114-218:0.62375):0.96100):0.10293):0.20778,YDGH_BACSU/112-216:1.05235):0.39102,MMPLC_MYCTU/132-243:0.28234):0.25059,MMPL8_MYCTU/150-260:0.31920):0.09212,MMPLA_MYCTU/105-216:0.13663,MMPLA_MYCLE/131-245:0.14401);
RTP  ((((((((((((MMPL1_MYCTU/128-239,MMPL2_MYCTU/130-240),(Q50085_MYCLE/4-113,(MMPL9_MYCTU/134-245,MMPL5_MYCTU/139-250))),(MMPL4_MYCLE/132-243,MMPL4_MYCTU/135-246)),Q9XCF6_MYCAV/129-240),Q9XCF5_MYCAV/131-242),(Q9XB10_MYCBO/119-230,MMPL7_MYCTU/150-261)),((MMPLA_STRCO/111-222,MMPLD_STRCO/118-225),MMPLB_STRCO/126-235)),((((Q9XB10_MYCBO/698-812,((MMPLA_MYCLE/768-882,(MMPL8_MYCTU/803-917,MMPLA_MYCTU/735-849)),MMPLC_MYCTU/756-870)),(MMPL9_MYCTU/702-816,(((MMPL2_MYCTU/697-811,MMPL6_MYCTU/124-238),((Q50086_MYCLE/127-241,MMPL5_MYCTU/708-822),(Q9XCF5_MYCAV/701-815,Q9XCF6_MYCAV/697-811))),MMPL1_MYCTU/696-810))),MMPLA_STRCO/452-559),(((Q9RKC1_STRCO/118-220,Q9RL63_STRCO/118-220),P96687_BACSU/117-220),Q9Z577_STRCO/114-218))),YDGH_BACSU/112-216),MMPLC_MYCTU/132-243),MMPL8_MYCTU/150-260),MMPLA_MYCTU/105-216,MMPLA_MYCLE/131-245);
RTL  22.2255
LNK  MMPL1_MYCTU/128-239:P95211:BX842573
LNK  MMPL1_MYCTU/696-810:P95211:BX842573
LNK  MMPL2_MYCTU/130-240:Q11171:BX842573
LNK  MMPL2_MYCTU/697-811:Q11171:BX842573
LNK  MMPL4_MYCLE/132-243:P54881:U15183
LNK  MMPL4_MYCTU/135-246:O53735:BX842573
LNK  MMPL5_MYCTU/139-250:O53784:BX842574
LNK  MMPL5_MYCTU/708-822:O53784:BX842574
LNK  MMPL6_MYCTU/124-238:Q10773:BX842577
LNK  MMPL7_MYCTU/150-261:P65370:BX842581
LNK  MMPL8_MYCTU/150-260:O07800:BX842584
LNK  MMPL8_MYCTU/803-917:O07800:BX842584
LNK  MMPL9_MYCTU/134-245:P95235:BX842579
LNK  MMPL9_MYCTU/702-816:P95235:BX842579
LNK  MMPLA_MYCLE/131-245:Q49619:U00010
LNK  MMPLA_MYCLE/768-882:Q49619:U00010
LNK  MMPLA_MYCTU/105-216:P65372:BX842575
LNK  MMPLA_MYCTU/735-849:P65372:BX842575
LNK  MMPLA_STRCO/111-222:Q53902:M64683
LNK  MMPLA_STRCO/452-559:Q53902:M64683
LNK  MMPLB_STRCO/126-235:O54101:AL939125
LNK  MMPLC_MYCTU/132-243:Q50585:BX842576
LNK  MMPLC_MYCTU/756-870:Q50585:BX842576
LNK  MMPLD_STRCO/118-225:Q9XA86:AL939106
LNK  P96687_BACSU/117-220:P96687:AB001488
LNK  Q50085_MYCLE/4-113:Q50085:U15183
LNK  Q50086_MYCLE/127-241:Q50086:U15183
LNK  Q9RKC1_STRCO/118-220:Q9RKC1:AL939115
LNK  Q9RL63_STRCO/118-220:Q9RL63:AL939105
LNK  Q9XB10_MYCBO/119-230:Q9XB10:Y18606
LNK  Q9XB10_MYCBO/698-812:Q9XB10:Y18606
LNK  Q9XCF5_MYCAV/131-242:Q9XCF5:AF143772
LNK  Q9XCF5_MYCAV/701-815:Q9XCF5:AF143772
LNK  Q9XCF6_MYCAV/129-240:Q9XCF6:AF143772
LNK  Q9XCF6_MYCAV/697-811:Q9XCF6:AF143772
LNK  Q9Z577_STRCO/114-218:Q9Z577:AL939124
LNK  YDGH_BACSU/112-216:P96706:AB001488
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P96687_BACSU/117-220
ASQ  TIAKDGTVAYADIQYKSS-----ADDIKDYSIKHLKDSLKMADDEGLQTE.LSG------DVPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIG
DSQ  ACAATCGCGAAAGATGGCACAGTTGCCTATGCTGATATCCAGTATAAATCATCA---------------GCAGATGATATAAAGGATTACTCTATCAAACACTTAAAAGACAGTTTGAAAATGGCTGATGATGAAGGATTGCAAACTGAG...CTAAGCGGA------------------GATGTACCGGGAGCGGAGATGGAGATAGGCGGTGTCTCTGAAATTGTCGGCATTATCTTGGCTTTTGTCGTTTTAGCCATTACATTCGGTTCTTTATTAATAGCAGGTTTGCCGATTTTAACTGCACTGATTGGTTTAGGTGTAAGTATTGGACTGGTTTTGATTGGG
TRN  10010101100011000
NAM  Q9Z577_STRCO/114-218
ASQ  LISENADTAYATVTFEDA-----SQDLDPGQARAVVDTAEAAETGGLRIE.LGG-----GAIALTESGGSHLAEAVGVAVAAVVLFLAFGSVAAALLPIATALVSVGTAYAGITLL
DSQ  CTGATCAGCGAGAACGCCGACACCGCGTACGCCACCGTCACCTTCGAGGACGCC---------------TCCCAGGACCTCGACCCGGGCCAGGCACGGGCCGTCGTCGACACCGCAGAGGCCGCCGAGACCGGCGGACTCCGGATCGAA...CTGGGCGGC---------------GGCGCCATAGCGCTCACCGAGTCCGGCGGCAGCCACCTCGCCGAGGCCGTCGGCGTGGCCGTGGCCGCGGTCGTCCTGTTCCTCGCCTTCGGCTCCGTCGCCGCCGCGCTGCTGCCCATCGCCACCGCGCTGGTCTCCGTCGGCACCGCCTACGCCGGCATCACGCTCCTC
TRN  10010111100111011
NAM  Q9RL63_STRCO/118-220
ASQ  TVSQDGSTAYATVTYEVT-----EDNVTDAGRADLTAAVERARTSGLTVE.AGG-------GAVAGEPPAGIGEFLGIGVAAVVLLITFGSLAAAGLPLITAVVGVALTLASIVAL
DSQ  ACGGTCAGCCAGGACGGATCCACGGCGTACGCCACCGTCACCTACGAGGTGACC---------------GAGGACAACGTCACCGACGCCGGACGGGCGGATCTCACGGCGGCGGTGGAGCGGGCCCGGACCTCCGGCCTGACCGTCGAG...GCCGGCGGC---------------------GGGGCCGTGGCCGGTGAGCCGCCGGCCGGGATCGGCGAGTTCCTGGGCATCGGCGTCGCCGCGGTGGTCCTGCTGATCACCTTCGGCTCGCTGGCGGCCGCCGGACTGCCGCTGATCACCGCCGTCGTCGGCGTGGCCCTCACCCTCGCCTCGATCGTCGCGCTG
TRN  11011111101111111
NAM  Q9RKC1_STRCO/118-220
ASQ  AVSEDGTIAYASVKYDVS-----GMELEESTKDALEDAAQQARDAGLTVE.IGG-------DALQAVPETGATEVIGIAVAAVVLVITFGSLVSAGLPLLTALIGVGIGVSSITAL
DSQ  GCCGTCAGCGAGGACGGCACCATCGCCTACGCCTCGGTGAAGTACGACGTCTCC---------------GGCATGGAGCTGGAGGAGTCCACCAAGGACGCCCTGGAGGACGCCGCCCAGCAGGCGCGCGACGCCGGGCTGACCGTCGAG...ATCGGCGGT---------------------GACGCGCTCCAGGCCGTCCCGGAGACCGGCGCCACCGAGGTCATCGGCATCGCGGTCGCCGCCGTCGTCCTGGTCATCACCTTCGGTTCCCTGGTCTCGGCCGGGCTGCCGCTGCTCACCGCCCTGATCGGCGTCGGCATCGGCGTCTCCTCGATCACCGCGCTG
TRN  11011111101111111
NAM  MMPLB_STRCO/126-235
ASQ  LVSQDRGAQLVIVPMEGSPSDESFQNAVDEVRALASD-----RAGPADVA.VTGPAGIATDTVKVFSGGDKVLLLATVVLVLIILLAIYRSPLMALVPLLAVGVAMRVAETLGAIL
DSQ  TTGGTCTCGCAGGACCGCGGTGCTCAGCTGGTCATCGTGCCCATGGAGGGCAGCCCCTCGGACGAGTCCTTCCAGAATGCGGTCGACGAGGTGCGTGCCCTCGCGTCCGAC---------------CGGGCCGGGCCCGCCGACGTCGCG...GTGACCGGCCCCGCCGGGATCGCCACCGACACCGTGAAGGTCTTCAGCGGCGGTGACAAAGTCCTGCTGCTGGCCACCGTCGTGCTCGTCCTGATCATCCTGCTGGCGATCTACCGCTCGCCCCTGATGGCGCTCGTGCCGCTTCTTGCCGTGGGCGTGGCTATGCGCGTGGCGGAGACTCTCGGCGCGATTCTC
TRN  11011101101011011
NAM  MMPLD_STRCO/118-225
ASQ  LPSDDGRALQAVVQVEPDLGERLP-DVLADIGDAAGQVP------GTRAQ.LAGPAASQADLSDAFAGIDGLLLAVALITVLVILLLVYRSVLLPLVIILSAVFALALSCAIVYAL
DSQ  CTGCCCTCGGACGACGGCCGGGCGCTCCAGGCCGTCGTCCAGGTCGAGCCGGACCTCGGCGAACGGCTCCCG---GACGTGCTGGCGGACATCGGTGACGCCGCCGGGCAGGTCCCC------------------GGCACCCGGGCGCAG...CTCGCCGGGCCCGCGGCCTCCCAGGCCGACCTCTCCGACGCCTTCGCGGGCATCGACGGACTGCTGCTCGCCGTCGCGCTGATCACGGTCCTGGTGATCCTGCTGCTCGTCTACCGCAGCGTGCTGCTGCCGCTGGTCATCATCCTGAGCGCGGTCTTCGCGCTGGCCCTGTCCTGCGCCATCGTCTACGCCCTG
TRN  11011111101111111
NAM  MMPLA_STRCO/111-222
ASQ  VRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPS---APDGLGVH.VTGPTGYAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLL
DSQ  GTGCGCTCGGACGACGGCAAGGCCCTGCGCACCGTCGTCAACGTCCACCTCGGCAAGGACGGCTGGGAGGGGCTCAACGCGGCCGCGAAGGACATGCGGGCGATCGCCCGGCCGAGC---------GCCCCGGACGGTCTCGGCGTCCAC...GTCACGGGTCCGACCGGTTACGCCGCCGATTCCGCAGAGTCCTTCAGCAGCGCCGACTTCAAGCTCACCCTGGTCACCCTCCTCATCGTCGTGACGATCCTCGTCGTCACCTATCGCAGTCCCTTGCTCTGGCTGCTGCCGATGATCTCCGCGGGCATGTCCCTGGTCATCTCGCAGGCCATCGTCTACCTGCTG
TRN  11011111101111111
NAM  MMPL7_MYCTU/150-261
ASQ  GTSPDGRSATAMVWLRGEAGTTQAAESLDAVRSVLRQLP---PSEGLRAS.IVVPAITNDMPMQITAWQSATIVTVAAVIAVLLLLRARLSVRAAAIVLLTADLSLAVAWPLAAVV
DSQ  GGAACCAGCCCCGACGGCCGCTCCGCTACGGCCATGGTGTGGCTGCGGGGCGAGGCGGGCACCACCCAAGCTGCCGAATCCCTCGATGCCGTCCGATCGGTGCTGCGCCAGTTACCG---------CCCAGTGAGGGGCTTCGCGCCAGC...ATCGTGGTCCCGGCAATCACCAACGACATGCCGATGCAGATAACCGCCTGGCAGAGCGCGACGATCGTGACCGTTGCGGCGGTGATCGCCGTCCTACTGCTGCTGCGGGCGCGCCTGTCGGTGCGGGCCGCGGCGATCGTGCTGCTGACCGCGGACTTGTCGCTTGCGGTGGCCTGGCCGCTGGCCGCGGTGGTG
TRN  10010111100111010
NAM  Q9XB10_MYCBO/119-230
ASQ  ARSDDHHAVTAALRFGGMVGTSQAGESITAARSIVTQLH---PPDGLHVF.VTGPGATIVDEFAAIDRQTQLITATTIVVLLILLLIVYRSAITATVPLLSVVVSLAVAKPIVSVL
DSQ  GCCCGCAGCGACGACCATCACGCGGTGACAGCTGCCCTGCGCTTTGGGGGCATGGTCGGAACGTCGCAAGCCGGGGAGTCGATAACCGCCGCGCGCAGCATCGTTACCCAACTGCAT---------CCCCCCGACGGTTTGCACGTATTC...GTCACCGGTCCTGGCGCCACCATCGTGGACGAGTTCGCGGCAATCGACAGACAGACCCAGCTCATTACGGCAACGACAATCGTGGTGTTACTGATCCTCTTGTTGATCGTCTACCGATCCGCGATCACCGCGACGGTGCCGTTGTTGTCGGTCGTCGTTTCCCTAGCCGTGGCCAAGCCGATCGTTTCCGTCCTT
TRN  10010101100011010
NAM  Q9XCF5_MYCAV/131-242
ASQ  AQSQDGKAAYVQVNLNGNAGAAAGDESVAAIRKLVQEAS---PPPGLKVY.VTGPAPIVADMNIAGQKTVMLVTLASLIVIFVTLLLVYRSVITVILLLLIVGLELQIARGMVALL
DSQ  GCGCAAAGCCAGGACGGCAAGGCCGCCTACGTTCAGGTGAACCTGAACGGAAATGCGGGCGCGGCCGCCGGTGACGAATCCGTGGCGGCAATTCGGAAGCTGGTCCAGGAGGCTTCT---------CCCCCGCCAGGTCTCAAGGTTTAC...GTCACCGGTCCCGCACCGATCGTCGCGGACATGAACATCGCGGGGCAAAAGACGGTCATGCTGGTGACGCTGGCCAGCCTGATCGTCATCTTCGTGACGCTGCTGCTGGTATATCGATCGGTCATCACCGTCATTCTGCTGTTGCTGATCGTCGGCCTGGAATTGCAGATCGCGCGCGGAATGGTCGCGCTACTG
TRN  11011111101111111
NAM  Q9XCF6_MYCAV/129-240
ASQ  AQSPDGKAVYVQLNLAGNQGTTLGQESVAAVRDAIARIP---PPAGLKAY.VTGPAALFSDMQLAGDRSILKMTLIGALIIFIVLLFVYRSVTTVVLLLLTVGIEVFAARGVIAFV
DSQ  GCGCAAAGCCCGGACGGCAAGGCCGTTTACGTCCAGTTGAATCTGGCCGGCAACCAGGGCACCACGCTGGGCCAGGAATCGGTGGCGGCCGTCCGTGACGCGATCGCGCGGATCCCA---------CCGCCCGCCGGACTGAAGGCCTAC...GTCACCGGGCCCGCGGCGCTGTTCTCCGATATGCAGCTCGCCGGTGACCGCTCGATCCTGAAGATGACCCTGATCGGCGCGCTGATCATTTTCATCGTGCTGCTCTTCGTCTACCGCTCGGTGACCACCGTCGTGTTGCTGTTGCTCACGGTGGGCATCGAAGTCTTCGCCGCGCGGGGCGTGATCGCCTTCGTC
TRN  11011111101111111
NAM  MMPL5_MYCTU/139-250
ASQ  AQSSDGKAAYVQVKLAGNQGESLANESVEAVKTIVERLA---PPPGVKVY.VTGSAALVADQQQAGDRSLQVIEAVTFTVIIVMLLLVYRSIITSAIMLTMVVLGLLATRGGVAFL
DSQ  GCCCAGAGCAGCGACGGCAAGGCCGCCTACGTTCAGGTGAAACTCGCGGGCAATCAGGGCGAGTCACTGGCCAACGAGTCCGTGGAAGCGGTCAAGACCATCGTCGAGCGCCTTGCG---------CCGCCACCCGGTGTCAAGGTGTAC...GTCACCGGTTCGGCCGCGCTGGTCGCCGATCAGCAGCAGGCCGGCGACCGTAGTCTGCAGGTGATCGAGGCGGTCACGTTCACCGTGATCATCGTGATGTTGCTGCTGGTCTACCGGTCGATCATCACGTCGGCGATCATGCTGACGATGGTGGTGCTCGGGCTGCTCGCCACCCGCGGGGGCGTGGCTTTCCTC
TRN  11011101101011001
NAM  MMPL9_MYCTU/134-245
ASQ  AVSADGKAAYVQLYLAGNMGEALANESVEAVRKIVANST---PPEGIRTY.VTGPAALFADQIAAGDRSMKLITGLTFAVITVLLLLVYRSIATTLLILPMVFIGLGATRGTIAFL
DSQ  GCGGTCAGCGCAGATGGTAAGGCGGCGTACGTTCAACTTTACCTCGCCGGCAACATGGGTGAAGCACTCGCAAACGAATCCGTTGAAGCCGTCCGGAAAATTGTGGCGAATAGTACA---------CCGCCGGAAGGCATCAGAACCTAT...GTCACCGGACCGGCGGCCTTGTTTGCCGACCAAATCGCCGCCGGTGACCGAAGCATGAAGCTGATCACCGGATTAACGTTCGCGGTAATCACCGTGTTGCTGCTGCTCGTCTATCGCTCGATCGCCACCACGCTGCTGATTCTTCCCATGGTGTTTATTGGACTCGGCGCGACGCGTGGCACCATTGCCTTTCTT
TRN  10010101100011010
NAM  MMPL4_MYCTU/135-246
ASQ  VQSNDGKAAYVQLSLAGNQGTPLANESVEAVRSIVESTP---APPGIKAY.VTGPSALAADMHHSGDRSMARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVL
DSQ  GTGCAAAGTAACGACGGCAAGGCCGCCTATGTTCAACTGTCACTTGCCGGCAACCAAGGCACGCCGCTGGCCAACGAATCCGTCGAGGCAGTACGCAGCATCGTCGAAAGCACGCCC---------GCGCCGCCGGGCATAAAGGCCTAT...GTGACCGGACCATCCGCACTCGCCGCGGATATGCACCACAGTGGCGATAGATCCATGGCCAGGATCACCATGGTTACGGTCGCCGTGATCTTTATTATGTTGTTGCTCGTCTACCGGTCGATAATCACCGTGGTTCTCCTGCTGATCACGGTGGGGGTCGAATTGACGGCTGCGCGCGGAGTCGTAGCGGTTCTG
TRN  10010101100011001
NAM  MMPL4_MYCLE/132-243
ASQ  AQSNDGKAAYVQLSLAGNQGELLAQESIDAVRKIVVQTP---APPGITAW.VTGASALIADMHHSGDKSMIRITATSVIVILVTLLLVYRSFITVILLLFTVGIESAVARGVVALL
DSQ  GCCCAAAGCAATGACGGTAAGGCCGCCTATGTCCAATTGAGTCTAGCGGGTAACCAAGGTGAGTTGCTGGCTCAAGAATCCATCGATGCGGTCCGCAAAATCGTCGTGCAGACGCCT---------GCGCCTCCCGGAATAACGGCTTGG...GTCACTGGAGCGTCAGCCTTGATCGCGGACATGCATCATAGTGGCGACAAATCCATGATCCGGATCACCGCAACGAGTGTGATCGTGATTTTGGTGACGTTGCTGCTCGTCTATCGATCGTTCATCACCGTGATTCTGCTGCTTTTCACGGTCGGGATCGAATCGGCGGTGGCGCGGGGAGTCGTCGCGTTGCTC
TRN  10010101100011001
NAM  MMPL2_MYCTU/130-240
ASQ  SQSADDRAAYVVVYLVGN-NETEAYDSVHAVRHMVDTTP---PPHGVKAY.VTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLVLIMVGIDLGAIRGFIALL
DSQ  TCCCAAAGTGCGGATGATCGGGCCGCCTACGTCGTGGTGTACCTCGTCGGTAAC---AACGAAACCGAAGCGTATGACTCGGTCCACGCGGTGCGGCACATGGTGGACACCACACCG---------CCACCGCACGGGGTGAAGGCCTAT...GTCACCGGTCCGGCAGCACTCAATGCCGACCAGGCCGAGGCCGGAGACAAAAGTATCGCTAAGGTCACCGCGATCACGAGCATGGTGATCGCAGCAATGTTGCTAGTGATCTATCGCTCCGTAATTACCGCGGTTCTCGTCTTGATCATGGTCGGCATCGACCTCGGCGCAATCCGCGGATTCATCGCCTTGCTC
TRN  11011101111011011
NAM  MMPL1_MYCTU/128-239
ASQ  SQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVDSVP---PPPGIKAY.VTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIMLLTVGLELLAVRGIISTF
DSQ  TCGCAGAGCGCTGACGGCAAGGCAGCATATGTCCAGCTGAACCTCACTGGTGATCAGGGCGGCTCGCAGGCCAACGAGTCTGTCGCCGCCGTGCAACGCATCGTGGACAGCGTGCCA---------CCGCCGCCGGGGATCAAGGCTTAC...GTGACAGGCCCGGGTCCACTCGGCGCCGATCGAGTTGTATACGGCGACCGCAGCCTTCACACGATTACCGGCATCAGCATTGCGGTGATCGCGATCATGTTGTTCATCGCCTACCGCTCGCTTTCTGCTGCTCTGATCATGCTGCTGACGGTCGGGCTCGAGCTGCTGGCGGTCCGCGGCATCATCTCCACTTTT
TRN  11011111101111111
NAM  Q50085_MYCLE/4-113
ASQ  SQSSDNQAVYVQMYLASNQGKNLANES---VQQIVNGTP---ALSDIKAYmIGGAVPAGADQSTAGEHRVQQVTMITFLVDIVMLLFVYCSVVQVNLTLVMVVIELMVARQGIIFQ
DSQ  TCGCAAAGCTCGGACAATCAAGCGGTCTATGTGCAAATGTATCTGGCCAGTAACCAGGGCAAAAACTTAGCCAACGAGTCT---------GTCCAACAAATCGTGAACGGCACGCCG---------GCGCTGTCGGACATCAAGGCCTACatgATCGGTGGTGCGGTTCCAGCCGGTGCCGATCAGTCAACGGCGGGTGAGCACAGGGTTCAACAAGTCACGATGATCACCTTCCTAGTGGACATTGTTATGTTGCTTTTTGTCTACTGTTCTGTTGTTCAGGTGAACCTGACCCTCGTGATGGTGGTAATTGAGCTCATGGTGGCCCGGCAAGGTATCATTTTTCAG
TRN  10010101100011000
NAM  MMPLC_MYCTU/132-243
ASQ  LASKDNKAWNLPITFAGDAASPETQAAFKRVAAIVKQTV---AGTSLTVH.LSGPIATVADLTELGEKDVRIIEIGTAVSVLIILILVYRNLVTMLVPLATIGASVVTAQGTLSGL
DSQ  TTGGCCAGCAAGGACAACAAGGCTTGGAACCTGCCCATCACGTTCGCGGGCGATGCCGCGTCGCCTGAGACACAAGCGGCGTTCAAACGCGTCGCCGCGATCGTCAAGCAAACAGTC---------GCGGGAACCAGCCTGACCGTCCAC...CTCAGCGGTCCGATCGCCACGGTCGCCGACCTGACGGAGCTCGGCGAGAAAGATGTGCGGATCATCGAGATCGGCACCGCGGTCAGCGTGCTGATCATCCTGATCCTCGTCTATCGGAACCTGGTGACCATGCTGGTGCCGCTGGCCACCATCGGAGCGTCGGTGGTCACTGCGCAGGGCACGTTGTCCGGGCTC
TRN  11011101101011011
NAM  MMPL8_MYCTU/150-260
ASQ  MTSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQV---AGSTLTAN.LTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITMVLPLITIGMSVVVAQRLVA-I
DSQ  ATGACCAGCAAAGACAATCAGGCCTGGATCCTGCCGGTCGGCCTTCCCGGCGACCTGGGTTCGACCCAGTCCAAGCAGGCGTACGCCCGCGTCGCTGACATCGTCGAACACCAGGTC---------GCAGGCTCGACACTGACGGCTAAC...CTGACCGGGCCCGCGGCCACCGTCGCCGATCTGAACCTCACCGGGCAACGGGACCGCAGTCGCATCGAGTTTGCGATCACGATCCTGTTGTTGGTCATTTTGCTGATCATCTACGGGAATCCGATCACCATGGTGTTGCCATTGATAACAATTGGCATGTCCGTGGTGGTTGCACAGCGCCTCGTTGCA---ATA
TRN  10010101100011011
NAM  MMPLA_MYCLE/131-245
ASQ  LVSKDGKAWILPIVLAGELGTSASYQAYAGVAGIVKQTLESTAGSSLKAN.LTGPASTVADLTDAGARDRTSIELVIAVLLLTILMIIYRNPITMLLPLITIGASLMTAQAVVSGV
DSQ  CTGGTTAGCAAAGACGGCAAGGCGTGGATCCTGCCGATCGTCCTGGCCGGTGAGCTTGGCACGTCCGCGTCCTATCAGGCCTACGCAGGCGTCGCGGGCATCGTGAAACAAACCTTGGAAAGCACAGCCGGATCGTCTCTCAAGGCCAAC...TTAACGGGGCCGGCGTCCACCGTCGCTGACTTGACGGACGCCGGGGCACGAGATCGCACGTCGATCGAGCTGGTGATCGCCGTTTTGTTGCTAACTATTTTGATGATTATCTATCGCAACCCGATCACCATGTTGTTGCCGTTGATCACGATCGGTGCATCGTTGATGACTGCGCAGGCCGTGGTATCTGGCGTC
TRN  11011101101011010
NAM  MMPLA_MYCTU/105-216
ASQ  LGSKDGKAWILPIGLAGDLGTPKSYHAYTDVERIVKRTV---AGTTLTAN.VTGPAATVADLTDAGARDRASIELAIAVMLLVILMVIYRNPVTMLLPLVTIGASLMTAQALVAGV
DSQ  CTCGGTAGTAAAGATGGCAAGGCATGGATTCTGCCGATCGGTCTCGCGGGCGACCTGGGTACACCCAAGTCCTACCACGCTTACACCGACGTCGAACGCATCGTGAAACGAACTGTG---------GCCGGAACCACGTTGACGGCAAAC...GTGACAGGACCCGCAGCCACGGTGGCAGACCTGACCGACGCTGGGGCTCGGGATCGGGCTTCAATCGAGCTGGCGATCGCCGTGATGTTGCTAGTCATCTTGATGGTCATCTATCGCAACCCGGTTACCATGCTGTTGCCCCTGGTGACGATTGGCGCATCCTTGATGACCGCGCAGGCGTTGGTTGCCGGCGTG
TRN  11011101101011001
NAM  YDGH_BACSU/112-216
ASQ  LMSKDKKTVLMPVTITGS----------DKKAEKIADEIYQIVPDDLTAY.ITGASLINQDFAHSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGIL
DSQ  TTGATGTCGAAAGACAAGAAAACCGTTCTCATGCCTGTCACGATTACAGGTTCT------------------------------GATAAAAAGGCGGAAAAAATTGCGGACGAGATTTATCAAATCGTTCCTGATGACTTGACGGCATAT...ATTACGGGAGCTTCCCTTATCAACCAGGATTTCGCTCACAGCTCAGAGGAAGGGCTTAAGAAAACGGAAGTGATAACAGTCTGCCTGATCATCGGTTTACTGTTGATCGTGTTCCGATCTGTTGTGACGCCTTTTATCCCGATTGTGGTTGTCGGTTTTTCTTATCTGATCAGTCAATCTATACTGGGCATCCTT
TRN  10010101100011000
NAM  MMPLA_STRCO/452-559
ASQ  PQVKDGL-AYVEATLGAGADSPAAMRSVTAARETLA------RLDGAQAR.VGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALF
DSQ  CCACAGGTGAAGGACGGCCTC---GCCTATGTCGAGGCGACGCTCGGCGCCGGGGCGGACTCGCCGGCGGCCATGCGTTCGGTCACCGCGGCCCGCGAGACACTCGCC------------------CGGCTGGACGGTGCGCAGGCACGG...GTGGGCGGCAGCAGCGCCGTCGTGCACGACATGCGGGAGGCGTCCAGCCGCGACCGCGGTCTGATCATTCCGGTGATCCTCGCCGTGGTGTTCTGCATCCTCGCGCTGCTGCTGCGAGCACTGGTGGCGCCGCTGCTGCTGATCGCGAGCGTGGTGCTGTCCTTCTTCACCGCGCTCGGCCTCGCCGCCCTCTTC
TRN  11011111101111111
NAM  MMPLC_MYCTU/756-870
ASQ  FLSADGHAARYFVQSALNPATTEAMDQVNDILRVADSARPNTELEDATIG.LAGVPTALRDIRDYYNSDMKFIVIATIVIVFLILVILLRALVAPIYLIGSVLISYLSALGIGTLV
DSQ  TTCCTGTCGGCCGATGGTCATGCGGCGCGGTACTTCGTGCAGAGCGCGCTGAATCCGGCCACCACCGAGGCGATGGATCAGGTCAACGATATCCTCCGTGTTGCGGATTCCGCGCGACCGAATACCGAACTCGAGGATGCCACGATAGGT...CTGGCGGGGGTTCCGACTGCGCTGCGGGATATCCGCGACTACTACAACAGCGATATGAAATTCATCGTCATTGCGACGATCGTTATCGTATTCTTGATTCTCGTCATTCTGCTGCGCGCACTTGTGGCTCCGATATATCTGATAGGCTCGGTGCTGATTTCTTACTTGTCGGCCCTAGGCATAGGAACTCTCGTT
TRN  10010101100011011
NAM  MMPLA_MYCTU/735-849
ASQ  FISPDGHTVRYFIQTDLNPFSTAAMDQVNTIIDTAKGAQPNTSLADASIS.MSGYPVMLRDIRDYYERDMRLIVAVTVVVVILILMALLRAIVAPLYLVGSVVISYMSAIGLGVVV
DSQ  TTCATCTCGCCAGACGGGCATACCGTGCGGTACTTCATTCAGACCGACCTCAACCCGTTCAGCACTGCGGCCATGGATCAGGTCAACACGATCATTGACACAGCCAAAGGTGCACAGCCAAATACCTCCCTGGCTGACGCGTCGATATCA...ATGTCGGGTTACCCGGTCATGCTGAGGGACATCCGCGATTACTACGAGCGCGATATGCGGCTCATCGTCGCTGTGACCGTCGTCGTGGTGATCCTGATCCTCATGGCACTGCTGCGTGCGATAGTGGCGCCGCTGTACCTGGTCGGTTCGGTGGTCATCTCGTACATGTCGGCGATCGGGCTTGGTGTGGTGGTG
TRN  10010101100011001
NAM  MMPLA_MYCLE/768-882
ASQ  FISPDGHSVRYFIQTDLNPFSSAAMDQVNTILNVATGAQPNTTLSDASIY.LSGYTVTLRDTRDYYDRDLQLIVIVTMIVVLLILMALLRSIVAPIYLVGSVIVSYLSALGLCVLV
DSQ  TTCATCTCGCCAGACGGCCATTCGGTGCGGTACTTCATTCAAACCGATCTCAACCCGTTCAGCAGTGCGGCCATGGATCAGGTCAACACGATCCTCAACGTCGCCACAGGTGCTCAGCCAAACACCACATTGTCGGACGCGTCGATCTAC...CTTTCGGGCTATACCGTGACGCTTCGAGACACCAGAGACTACTACGACCGAGATCTGCAGCTTATAGTCATCGTCACGATGATTGTGGTGCTTTTGATCCTTATGGCACTATTGCGCTCGATAGTTGCGCCAATATACCTCGTCGGGTCGGTGATTGTTTCGTATCTGTCGGCACTCGGACTCTGTGTCTTGGTG
TRN  10010101100011011
NAM  MMPL8_MYCTU/803-917
ASQ  FISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNTALADAKVS.VVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLIGSVIVSYLAALGIGVIV
DSQ  TTCATTTCACCCGACGGCCACTCAATACGGTATTTGATACAAACCGACCTGAATCCATTCAGCACTGCTGCCATGGACCAAATTGACGCGATCACGGCGGCCGCTCGAGGGGCGCAACCAAATACCGCACTGGCCGATGCCAAGGTGTCT...GTCGTCGGATTGCCCGTCGTTCTCAAGGACACGCGCGACTACTCCGATCACGACCTCCGATTGATCATCGCCATGACCGTCTGCATCGTTCTGCTCATATTGATCGTTTTGCTGCGTGCGATTGTGGCACCGCTGTATCTGATCGGCTCGGTTATCGTATCGTACCTGGCGGCGCTCGGTATTGGCGTTATCGTG
TRN  10010111100111001
NAM  Q9XB10_MYCBO/698-812
ASQ  FVSPNGHATRLLVYGDGSEWGDDGAQRARAIVTAVAEETDEGTLRPTAVE.LTGVGPATRDLQDLVGSDLTLLAVITLAVIFAIAALLLRSPLAGLVVVGTIATSYICALGASVVI
DSQ  TTTGTCTCACCAAACGGCCATGCAACGCGTTTACTCGTCTACGGCGACGGGAGCGAGTGGGGTGACGATGGCGCCCAACGCGCTCGCGCGATCGTGACTGCGGTGGCCGAGGAAACCGACGAGGGCACGCTGCGACCCACCGCTGTTGAG...CTGACCGGCGTTGGACCGGCTACCCGTGACCTGCAGGATCTGGTGGGCAGTGACCTGACCTTGCTGGCGGTCATCACACTGGCCGTTATCTTCGCGATAGCCGCACTGCTGCTGCGCAGTCCGCTTGCCGGGCTTGTGGTCGTCGGCACAATCGCGACATCGTATATCTGTGCGCTTGGCGCCAGCGTAGTGATT
TRN  10010111100111000
NAM  MMPL6_MYCTU/124-238
ASQ  FLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIY.LAGTAATFKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLV
DSQ  TTCCTGTCGGCAGACGGTAAGGCGGCTCGGATGATCATCTCCCATGAAGGCGATCCCGCCACCCCCGAAGGCATTTCGCATATCGACGCGATCAAGCAGGCGGCCCACGAGGCCGTGAAGGGCACTCCCATGGCGGGTGCTGGGATCTAT...CTGGCCGGCACGGCCGCCACCTTCAAGGACATTCAAGACGGCGCCACCTACGACCTCCTGATCGCCGGAATAGCCGCGCTGAGCTTGATTTTGCTCATCATGATGATCATTACCCGAAGCCTGGTTGCGGCGCTGGTGATCGTGGGCACGGTGGCGCTGTCGTTGGGCGCTTCTTTTGGCCTGTCCGTGCTGGTG
TRN  10010111100111011
NAM  MMPL2_MYCTU/697-811
ASQ  FLSPDGKAARFVIALEGDPATPEGISRVEPIKREAREAIKGTPLQGAAIY.LGGTAATFKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLV
DSQ  TTTTTGTCTCCGGACGGCAAGGCAGCCCGCTTTGTCATTGCTCTGGAGGGAGATCCCGCAACGCCCGAGGGCATCTCTCGGGTCGAGCCGATCAAGCGGGAGGCTAGAGAGGCCATAAAGGGAACTCCATTGCAGGGCGCTGCGATCTAT...CTGGGTGGCACCGCGGCGACGTTCAAGGATATTCGAGAGGGCGCCAGATACGATCTGCTGATCGCCGGAGTGGCGGCGATAAGCTTGATTTTGATCATCATGATGATCATCACCCGAAGTGTGGTAGCCGCAGTGGTTATCGTGGGTACCGTCGTGCTTTCCATGGGCGCCTCTTTCGGGCTTTCCGTATTGGTC
TRN  10010101100011011
NAM  Q9XCF6_MYCAV/697-811
ASQ  FLSPDGKAARFIISHRGDPATSEALNRIDKIRSAAEEALKNTPLENAKIY.LAGTASTFKDFRDGSTYDLFIAGVGALCLIFIIMLILTRSFIAALIIVGTVTLSLGASFGLSVLI
DSQ  TTCCTGTCGCCCGACGGAAAGGCGGCCCGCTTCATCATTTCGCACCGGGGCGACCCGGCCACCTCGGAAGCCCTGAACCGCATCGACAAGATCAGATCGGCGGCCGAGGAGGCGCTCAAGAACACTCCCCTGGAGAACGCCAAGATCTAC...CTCGCCGGCACCGCGTCGACGTTCAAGGACTTCCGCGACGGATCCACCTACGACCTATTCATCGCCGGCGTCGGTGCGCTTTGCCTGATCTTCATCATCATGCTGATTCTGACCCGAAGCTTCATCGCCGCGCTGATCATCGTCGGCACGGTGACGCTGTCACTGGGCGCCTCATTCGGGTTGTCGGTGCTGATC
TRN  10010101100011001
NAM  Q9XCF5_MYCAV/701-815
ASQ  FMSPDGKDVRLLISQRGDPATPEGLSRVEQIKTAAEEALKGTPLENSRIY.LTGTAAITKDLAQGSKFDLLIAGVSALCLIFIIMLIMTRSFIAAMVIVGTVLLSLGASFGLSVLV
DSQ  TTCATGTCGCCCGACGGCAAGGACGTCCGGCTGCTGATCTCGCAGCGCGGTGACCCTGCCACACCCGAGGGCCTGTCCCGGGTGGAACAGATCAAGACCGCGGCCGAAGAAGCGCTCAAGGGAACACCGCTGGAGAATTCCAGGATCTAT...CTGACCGGCACCGCGGCCATCACCAAGGATTTGGCCCAGGGATCGAAATTCGACCTGTTGATCGCCGGCGTCTCCGCGCTCTGCCTGATCTTCATCATCATGCTGATCATGACGCGCAGTTTCATCGCGGCCATGGTGATCGTGGGCACGGTGTTGCTGTCGCTGGGGGCGTCGTTCGGGCTGTCGGTGCTGGTG
TRN  10010101100011011
NAM  MMPL5_MYCTU/708-822
ASQ  FLSPDGHAVRFIISHEGDPMSQAGIARIAKIKTAAKEAIKGTPLEGSAIY.LGGTAAMFKDLSDGNTYDLMIAGISALCLIFIIMLITTRSVVAAAVIVGTVVLSLGASFGLSVLI
DSQ  TTCCTCTCGCCGGACGGGCACGCGGTGCGGTTCATCATCAGCCACGAAGGCGACCCGATGAGCCAGGCGGGCATCGCGCGCATCGCCAAGATCAAGACCGCCGCCAAGGAAGCCATCAAGGGCACACCGTTGGAGGGATCCGCGATCTAC...CTGGGCGGTACCGCGGCGATGTTCAAGGACTTGTCCGACGGCAACACCTATGACTTGATGATCGCCGGAATCTCCGCACTCTGCCTGATCTTCATCATCATGCTGATCACCACCCGCAGCGTCGTCGCGGCCGCCGTCATCGTCGGCACCGTGGTGTTGTCGCTGGGCGCCTCGTTCGGGCTGTCGGTGCTGATC
TRN  11011111101111111
NAM  Q50086_MYCLE/127-241
ASQ  FLSSDGHAARFIILHRGDPASVAGIASINAIRTAAEEALKGTPLEDTKIY.LAGTAAVFKDIDEGANWDLVIAGISSLCLIFIIMLIITRAFVAAAVIVGTVALSLGASFGLSVLL
DSQ  TTCCTGTCATCGGATGGACACGCGGCTCGCTTCATTATTTTACATCGGGGGGATCCCGCCAGCGTCGCGGGTATCGCGAGTATCAACGCGATACGCACGGCAGCCGAGGAGGCTCTCAAGGGCACCCCATTGGAGGACACCAAGATCTAC...CTGGCCGGTACGGCGGCCGTCTTCAAGGACATCGACGAGGGCGCTAACTGGGATCTCGTGATCGCGGGGATTTCATCGCTTTGCCTGATTTTCATCATCATGCTGATCATTACTCGAGCCTTTGTAGCCGCCGCTGTTATCGTGGGTACGGTCGCGCTTTCACTAGGCGCCTCCTTTGGACTGTCCGTATTGCTC
TRN  10010111100111000
NAM  MMPL1_MYCTU/696-810
ASQ  FLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIY.LAGTSSTYKDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLI
DSQ  TTCCTATCCCCCGATGGCACCTGCGCTCGATTCGTCATCACCCATCGGGGTGATCCCGCGAGCGCTGAAGGCATCTCACACATCGACCCCATCATGCAGGCCGCCGACGAAGCCGTGAAAGGAACCCCGCTACAGGCTGCCAGCATCTAT...CTGGCGGGCACCTCATCCACCTACAAAGACATCCACGAGGGCACCCTGTATGACGTCATGATCGCCGTCGTGGCGTCGCTTTGCCTGATCTTCATCATCATGCTCGGCATCACCAGAAGCGTGGTCGCATCCGCCGTCATCGTCGGCACGGTCGCCCTTTCGCTGGGCTCAGCCTTCGGATTGTCGGTCCTCATC
TRN  10010101100011001
NAM  MMPL9_MYCTU/702-816
ASQ  FLSPNGKAVRFVISHESDPASTEGIDRIEAIRAATKDAIKATPLQGAKIY.IGGTAATYQDIRDGTKYDILIVGIAAVCLVFIVMLMITQSLIASLVIVGTVLLSLGTAFGLSVLI
DSQ  TTTTTGTCGCCGAATGGTAAGGCGGTGCGCTTCGTAATTTCCCACGAGAGCGATCCAGCAAGTACTGAAGGTATCGATCGCATCGAAGCGATAAGGGCCGCGACCAAAGATGCCATCAAGGCGACACCATTGCAAGGCGCTAAAATCTAT...ATCGGTGGCACGGCTGCGACCTACCAAGACATTCGAGACGGTACCAAGTACGATATCCTCATCGTTGGTATAGCCGCGGTATGCCTGGTATTTATTGTCATGCTCATGATTACCCAGAGCCTGATTGCGTCACTCGTCATTGTTGGCACGGTACTTCTGTCATTGGGTACTGCGTTCGGACTGTCCGTGCTCATC
TRN  10010101100011001
//