EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03172 - Sp100)
FAM  PF03172
PID  Sp100
DES  Sp100 domain
IPR  IPR004865
ANO  4
ALN  106
AID  0.359232
APH  ((S100R_MOUSE/19-122:0.28360,AIRE_HUMAN/1-106:2.20911):0.27043,LY10_HUMAN/36-139:0.54657,SP10_HUMAN/47-150:0.13108);
ATP  ((S100R_MOUSE/19-122,AIRE_HUMAN/1-106),LY10_HUMAN/36-139,SP10_HUMAN/47-150);
ATL  3.44079
DNO  4
DLN  318
DID  0.519765
DPH  ((S100R_MOUSE/19-122:0.14519,AIRE_HUMAN/1-106:1.23986):0.13939,LY10_HUMAN/36-139:0.29090,SP10_HUMAN/47-150:0.09973);
DTP  ((S100R_MOUSE/19-122,AIRE_HUMAN/1-106),LY10_HUMAN/36-139,SP10_HUMAN/47-150);
DTL  1.91507
RID  0.359232
RPH  ((S100R_MOUSE/19-122:0.28360,AIRE_HUMAN/1-106:2.20911):0.27043,LY10_HUMAN/36-139:0.54657,SP10_HUMAN/47-150:0.13108);
RTP  ((S100R_MOUSE/19-122,AIRE_HUMAN/1-106),LY10_HUMAN/36-139,SP10_HUMAN/47-150);
RTL  3.44079
LNK  AIRE_HUMAN/1-106:O43918:AB006682
LNK  LY10_HUMAN/36-139:Q13342:U36499
LNK  S100R_MOUSE/19-122:Q99388:M55219
LNK  SP10_HUMAN/47-150:P23497:U36501
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  AIRE_HUMAN/1-106
ASQ  MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDL
DSQ  ATGGCGACGGACGCGGCGCTACGCCGGCTTCTGAGGCTGCACCGCACGGAGATCGCGGTGGCCGTGGACAGCGCCTTCCCACTGCTGCACGCGCTGGCTGACCACGACGTGGTCCCCGAGGACAAGTTTCAGGAGACGCTTCATCTGAAGGAAAAGGAGGGCTGCCCCCAGGCCTTCCACGCCCTCCTGTCCTGGCTGCTGACCCAGGACTCCACAGCCATCCTGGACTTCTGGAGGGTGCTGTTCAAGGACTACAACCTGGAGCGCTATGGCCGGCTGCAGCCCATCCTGGACAGCTTCCCCAAAGATGTGGACCTC
TRN  10010101100011011
NAM  LY10_HUMAN/36-139
ASQ  QVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEH-FQEAFRNLVPVTRVMYCVLSELEKTFGWSHLE-ALFSRINLMAYPDLNEIYRSFQNVCYE
DSQ  CAGGTTTGCCCTGAGCCCATTTTCAGGTTCTTCAGAGAAAACAAGGTGGAGATTGCAAGTGCAATAACAAGGCCATTTCCTTTCCTTATGGGCCTCCGAGACCGCTCCTTCATCTCCGAGCAGATGTATGAACAT---TTTCAAGAAGCTTTTAGAAACCTGGTCCCAGTGACAAGAGTGATGTATTGTGTACTCAGTGAACTGGAGAAGACATTTGGCTGGTCACATCTGGAA---GCATTGTTCAGCAGGATTAACCTGATGGCCTATCCTGATTTAAACGAGATTTACAGAAGCTTCCAGAATGTATGCTATGAA
TRN  10010101100011000
NAM  SP10_HUMAN/47-150
ASQ  RLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFED-SQDSCRNLVPVQRVVYNVLSELEKTFNLPVLE-ALFSDVNMQEYPDLIHIYKGFENVIHD
DSQ  AGGCTGCTCTATGACATTGTATTCAAGCACTTCAAAAGAAATAAGGTGGAGATTTCAAATGCAATAAAAAAGACATTTCCATTCCTCGAGGGCCTCCGTGATCGTGATCTCATCACAAATAAAATGTTTGAAGAT---TCTCAAGATTCTTGTAGAAACCTGGTCCCTGTACAGAGAGTGGTGTACAATGTTCTTAGTGAACTGGAGAAGACATTTAACCTGCCAGTTCTGGAA---GCACTGTTCAGCGATGTCAACATGCAGGAATACCCCGATTTAATTCACATTTATAAAGGCTTTGAAAATGTAATCCATGAC
TRN  10010101100011000
NAM  S100R_MOUSE/19-122
ASQ  MHLIECMLKHFKIQKVAISNAIRSTFPFLESLRDREFITGKMYED-LLDSCRSLVPVDKVIYRALEELEKKFDMTVLC-KLFNEVNMEKYPDLNLLRRSFECGAKP
DSQ  ATGCATCTCATTGAATGTATGTTAAAGCACTTCAAGATACAGAAAGTGGCCATTTCTAATGCGATAAGAAGTACATTTCCTTTTCTTGAGAGCCTCCGAGACCGTGAATTCATCACTGGTAAAATGTATGAAGAT---TTGCTAGATTCCTGTAGATCGCTGGTCCCTGTGGACAAAGTGATCTACAGAGCCCTGGAGGAACTGGAGAAGAAATTTGACATGACGGTACTGTGC---AAATTGTTCAATGAGGTCAACATGGAGAAGTACCCCGATTTGAATCTCCTTCGTAGAAGCTTTGAATGTGGAGCCAAGCCA
TRN  10010101100011010
//