EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03162 - Y_phosphatase2)
FAM  PF03162
PID  Y_phosphatase2
DES  Tyrosine phosphatase family
IPR  IPR004861
ANO  8
ALN  185
AID  0.287471
APH  ((((YNF6_YEAST/3-169:0.74218,O13635_SCHPO/88-264:0.77638):0.12111,(YNJ9_YEAST/67-236:0.64806,(Q12454_YEAST/3-180:0.90805,Q9U0Z9_LEIMA/398-559:0.95939):0.39222):0.15440):0.00000,YCY5_YEAST/62-220:1.83594):0.32348,YND2_YEAST/116-280:0.32582,Q9ZVN4_ARATH/53-215:0.36638);
ATP  ((((YNF6_YEAST/3-169,O13635_SCHPO/88-264),(YNJ9_YEAST/67-236,(Q12454_YEAST/3-180,Q9U0Z9_LEIMA/398-559))),YCY5_YEAST/62-220),YND2_YEAST/116-280,Q9ZVN4_ARATH/53-215);
ATL  7.5145
DNO  8
DLN  555
DID  0.406058
DPH  ((((YNJ9_YEAST/67-236:0.45605,(YNF6_YEAST/3-169:0.53499,YCY5_YEAST/62-220:0.90484):0.06977):0.05103,(Q9U0Z9_LEIMA/398-559:0.68613,Q12454_YEAST/3-180:0.65629):0.17243):0.13579,O13635_SCHPO/88-264:0.61117):0.11417,YND2_YEAST/116-280:0.34143,Q9ZVN4_ARATH/53-215:0.36659);
DTP  ((((YNJ9_YEAST/67-236,(YNF6_YEAST/3-169,YCY5_YEAST/62-220)),(Q9U0Z9_LEIMA/398-559,Q12454_YEAST/3-180)),O13635_SCHPO/88-264),YND2_YEAST/116-280,Q9ZVN4_ARATH/53-215);
DTL  5.11888
RID  0.287471
RPH  ((((YNF6_YEAST/3-169:0.74218,O13635_SCHPO/88-264:0.77638):0.12111,(YNJ9_YEAST/67-236:0.64806,(Q12454_YEAST/3-180:0.90805,Q9U0Z9_LEIMA/398-559:0.95939):0.39222):0.15440):0.00000,YCY5_YEAST/62-220:1.83594):0.32348,YND2_YEAST/116-280:0.32582,Q9ZVN4_ARATH/53-215:0.36638);
RTP  ((((YNF6_YEAST/3-169,O13635_SCHPO/88-264),(YNJ9_YEAST/67-236,(Q12454_YEAST/3-180,Q9U0Z9_LEIMA/398-559))),YCY5_YEAST/62-220),YND2_YEAST/116-280,Q9ZVN4_ARATH/53-215);
RTL  7.5145
LNK  O13635_SCHPO/88-264:O13635:AB004537
LNK  Q12454_YEAST/3-180:Q12454:X84162
LNK  Q9U0Z9_LEIMA/398-559:Q9U0Z9:AL139794
LNK  Q9ZVN4_ARATH/53-215:Q9ZVN4:AC005322
LNK  YCY5_YEAST/62-220:P25366:X59720
LNK  YND2_YEAST/116-280:P53965:Z71308
LNK  YNF6_YEAST/3-169:P53949:U12141
LNK  YNJ9_YEAST/67-236:P50946:Z50161
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O13635_SCHPO/88-264
ASQ  PLVPDNFGVVYPG--IIYRSACPRASNFNFLES-LHIRTIISLRQEEYSEEDLH--YFTKHHINYYHIAMPGSKHRKNDCISSS.SNPDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVIGCLR-ALMNWPVGNRLQEYISFSHP-KEREVDEEYIQNFSSDPSLKSSLNDLKRYISD
DSQ  CCGCTTGTACCAGATAATTTTGGGGTCGTTTATCCTGGA------ATTATTTATCGTTCTGCATGTCCACGTGCTTCTAATTTCAATTTCCTGGAATCC---TTACACATCCGTACCATTATATCATTAAGACAAGAAGAGTATTCCGAAGAGGATCTCCAC------TACTTCACTAAACATCACATTAATTATTATCATATTGCCATGCCTGGAAGCAAACATCGGAAAAACGATTGCATTTCCTCTTCC...TCAAATCCCGACATTTCAGACGTTGACGATCTTGTACGAAAAACTTTACAACTTCTTTTAAATAAAGAAAATTGGCCTGTTTTGCTCCATTGCAGTCGTGGAAAGCATCGCACAGGTATTGTAATTGGTTGTCTAAGA---GCATTGATGAATTGGCCAGTCGGAAATCGTTTACAGGAATATATATCCTTTTCACATCCC---AAAGAACGTGAAGTTGACGAAGAATATATTCAGAACTTTTCATCAGATCCATCTCTAAAGTCTTCTCTCAATGATTTGAAACGGTATATTAGTGAT
TRN  10010101100011000
NAM  Q9ZVN4_ARATH/53-215
ASQ  LIPPLNFSMVDN---GIFRSGFPDSANFSFLQT-LGLRSIIYLCPEPYPESNLQ--FLKSNGIRLFQFGIEGNKEP--------.---FVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLR-KLQKWCLTSIFDEYQRFAAA-KARVSDQRFMEIFDVSSFSHIP--MSFSCSIR
DSQ  CTAATTCCGCCGCTCAACTTCTCCATGGTCGATAAC---------GGTATATTCCGGTCTGGATTCCCTGATTCAGCTAACTTCTCCTTTCTCCAGACT---CTCGGTCTCCGCTCAATCATATACTTGTGCCCGGAGCCCTACCCAGAGAGCAATCTCCAG------TTCCTTAAATCCAATGGAATCAGGCTTTTCCAGTTTGGTATTGAAGGCAACAAGGAGCCA------------------------...---------TTTGTGAATATTCCAGACCATAAAATCCGCATGGCACTGAAAGTGCTTCTAGATGAGAAAAACCATCCTGTTCTGATTCATTGTAAGCGAGGCAAGCATCGGACCGGTTGTCTTGTTGGTTGCTTGAGG---AAGCTCCAGAAATGGTGTTTGACATCGATATTCGACGAGTACCAACGATTTGCAGCAGCG---AAAGCTAGAGTTTCAGATCAAAGATTCATGGAGATATTCGATGTTTCCAGCTTCAGTCATATTCCA------ATGTCATTCTCTTGTTCCATCAGG
TRN  10010101100011001
NAM  YND2_YEAST/116-280
ASQ  VIPPENFSHVVG---EIYRSSFPRQENFSFLHERLKLKSILVLIPEEYPQENLN--FLKLTGIKLYQVGMSGNKEP--------.---FVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIR-KLQNWSLTMIFDEYRRFAFP-KARALDQQFIEMYDDDEIKRIAS-KNNWLPLQ
DSQ  GTGATTCCTCCCGAAAACTTTAGCCACGTCGTTGGG---------GAGATATACCGTAGCAGTTTCCCACGACAAGAGAACTTTTCGTTTTTGCATGAAAGACTAAAGTTGAAATCCATCTTGGTACTAATTCCGGAAGAATATCCGCAGGAAAATCTAAAT------TTTTTGAAGTTAACGGGTATAAAATTATATCAAGTTGGAATGAGCGGTAATAAGGAGCCA------------------------...---------TTTGTTAATATACCGTCTCATCTACTGACAAAGGCACTAGAAATCGTGTTGAATCCTGCGAATCAACCGATACTGATACATTGTAATAGAGGCAAACATAGAACGGGGTGTTTGATTGGTTGTATAAGA---AAACTACAAAATTGGTCGCTAACGATGATTTTTGATGAGTACAGACGTTTCGCATTTCCG---AAGGCCAGGGCGCTTGATCAGCAGTTCATCGAGATGTATGACGATGACGAAATTAAGAGGATTGCTAGT---AAAAACAACTGGTTGCCTCTACAA
TRN  10010101100011010
NAM  YNJ9_YEAST/67-236
ASQ  IVPPLNFCPVER---YLYRSGQPSPVNFPFLLN-LKLKTIIWLSNE-EPQDTLLE-FCDTHRINLQFAAINPDAGEDD------.-NPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLR-RIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTNLVKIDKNKAPSWLLTA
DSQ  ATCGTTCCACCTTTGAATTTCTGTCCCGTTGAAAGA---------TACCTCTATAGATCTGGTCAGCCTTCACCTGTGAATTTCCCCTTTTTACTAAAC---CTAAAACTGAAAACAATTATATGGCTGTCTAACGAA---GAACCTCAAGATACCCTCCTAGAG---TTTTGTGATACTCATAGAATAAACTTACAATTCGCAGCCATCAACCCGGATGCCGGTGAGGACGAT------------------...---AATCCATGGGACGGTCTCACTGAACATTCTATAATTAATGTACTACAAACGATCGTCACTCAAGAGAATTATCCCTTGCTAGTGTGCTGTGGTATGGGAAGACATAGGACTGGGACAGTCATTGGATGTCTCAGA---AGAATAATGGGTTGGAACTTAGCCAGTGTATCCGAAGAATATAGACGCTTTACTGGTAGCAGAGGTGGTAGAATTCTTGTAGAGTTGCTTATAGAAGCTTTCGACACTAATTTAGTAAAAATAGACAAAAATAAAGCACCAAGTTGGTTACTGACAGCT
TRN  10010101100011000
NAM  YNF6_YEAST/3-169
ASQ  YIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQS-FLESEKIKYYHIFMDSSRD---------.-----EGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGICQEYGLFSGG-MKDGVDLEFITMFETNLKIPRNV-IPGFAKHC
DSQ  TACATACCCCCATTAAATTTTTCGCCAGTGGTGAGCACGGATGTATCGTTATATCGATCGGGATACCCGATGCCGTTAAATTATAGTTTCATCAAGCATCAGTTACACTTGAAGACCATAATATATATTGGCGATAAAGATAGGCCTCTCGAAGAATATCAAAGC---TTCCTGGAGTCAGAAAAGATAAAATACTATCACATATTTATGGATTCAAGCCGCGAT---------------------------...---------------GAAGGAATTCAAGAAAGAATGAACCAGGTCTTGCACTTGGTGCTGGATGTCAGAAACTATCCCATCTTAGTGCATTCCAATAAGGGCAAGCACCGTGTTGGTGTAGTTGTGGGAATCATAAGAAAGTTGTTACAGGGATGGTCCACTGCAGGTATATGCCAAGAGTACGGGTTATTTTCTGGTGGG---ATGAAAGATGGAGTAGATTTGGAGTTTATCACAATGTTCGAAACCAATCTGAAAATACCGAGAAACGTT---ATCCCTGGCTTTGCTAAACACTGC
TRN  10010101100011000
NAM  Q9U0Z9_LEIMA/398-559
ASQ  LVPPFRFARVES---GVYRGAYPVLRNFPYIRR-LRLRTMVSLIPEPPTYDLKC--FAEAEHIQLHHIHAERAKG---------.---EVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALR-KLLQWDANVANAEFQRFTRE---VQDEAAFIADYTGPLLVPPHLPAWLWGGSI
DSQ  CTCGTCCCGCCGTTCCGCTTCGCACGCGTGGAGTCC---------GGGGTGTACCGCGGCGCCTACCCCGTCCTGCGGAATTTCCCGTACATTCGGCGG---CTGCGACTGCGTACGATGGTGTCGCTCATTCCTGAGCCGCCGACGTACGACCTCAAGTGC------TTCGCGGAGGCAGAGCACATCCAGCTGCACCACATCCACGCCGAACGCGCCAAGGGC---------------------------...---------GAGGTGCAACTGTTGCCGTCGGAGCTGAGCGAGGCGCTGCAGCTCATCATGAACAAGGATATGCACCCCCTGTACATCCACTGTCTGGACGGCCGTCACGTCACCGGTCTCGTCATCATGGCGCTGCGC---AAGCTGCTGCAGTGGGATGCGAACGTCGCCAACGCCGAGTTTCAGCGCTTCACCCGCGAG---------GTGCAAGATGAGGCGGCGTTCATTGCTGACTACACCGGGCCTCTCCTAGTGCCACCGCACTTGCCGGCATGGCTCTGGGGTGGGTCCATC
TRN  11011111101111111
NAM  Q12454_YEAST/3-180
ASQ  LVTPLQFSTVQP---NLYRGSYPREINLPFLRT-LRLKYILSLTPEPLSTDPLMVKFCEENNIKTIHIKCQSERKADKTKPKIKrKKKTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELIISLVVACMR-KFSYWSTVSILNEFLVYNSS--INIHERNFIENFNSEIEVDDLDIKDKVPWIT
DSQ  CTAGTGACTCCGTTACAATTTTCGACTGTACAGCCA---------AATTTATATAGAGGATCTTACCCACGAGAAATCAATCTCCCATTCCTGAGAACC---CTTAGATTGAAATACATATTATCTTTGACACCAGAACCTTTGAGCACTGATCCTCTAATGGTAAAGTTTTGTGAAGAAAATAACATTAAGACAATTCATATAAAATGTCAAAGTGAAAGAAAGGCAGACAAGACCAAACCCAAGATTAAAaggAAAAAGAAAACAGTTCCTATTGAATACGATGTTGTAGTACGATGCGTTAAATTTCTGATTGATAAAGGGCATTACCCCTGTTATATGCACTGTACGAATGGTGAATTGATAATATCTCTCGTAGTAGCATGTATGAGA---AAGTTTTCATATTGGAGTACGGTATCCATACTAAATGAGTTTTTGGTGTATAATTCCAGC------ATCAATATTCATGAAAGAAATTTCATTGAAAACTTTAACTCTGAAATCGAAGTTGACGATCTGGATATAAAGGATAAAGTTCCCTGGATTACC
TRN  10010101100011000
NAM  YCY5_YEAST/62-220
ASQ  VLRMSDFSAAAV---PVKSSSVSNANLYSNNNSTLSLQEEKKKSTANGSQNSTT--G-DPVIQEELAYHLTDNDD---------.---LMLIKSTCLKRTFKTLLNVDNYNVLLVD-----KTALVIGILR-KIQKWNIASIINEYRLFSGK-NRNYFAETFLEIINIEIEQEKDNKTIVDNKAK
DSQ  GTTTTAAGGATGTCTGATTTCTCGGCTGCGGCAGTT---------CCGGTAAAAAGCTCTTCTGTATCTAACGCAAATTTATATTCGAATAATAACAGTACTCTATCATTACAGGAAGAAAAGAAAAAATCCACTGCAAATGGGTCACAAAATTCTACTACA------GGG---GATCCTGTAATTCAGGAGGAATTGGCTTACCACTTGACTGACAATGATGAC---------------------------...---------TTAATGCTGATTAAGAGCACGTGTTTAAAAAGAACTTTCAAAACATTATTGAATGTGGATAATTATAATGTTTTATTGGTAGAT---------------AAGACCGCGTTGGTCATTGGTATACTTCGA---AAAATTCAGAAATGGAATATTGCATCAATCATAAATGAGTACAGATTATTTTCTGGTAAG---AATAGAAATTATTTTGCGGAAACATTTCTAGAAATAATTAACATTGAGATAGAACAGGAGAAGGATAATAAGACAATTGTGGACAACAAAGCAAAA
TRN  10010101100011000
//