EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03113 - RSV_NS2)
FAM  PF03113
PID  RSV_NS2
DES  Respiratory synctial virus non-structural protein NS2
IPR  IPR004336
ANO  2
ALN  124
AID  0.830357
APH  (VNS2_ORSVW/1-124:0.18804,VNS2_HRSVA/1-124:0.05410);
ATP  (VNS2_ORSVW/1-124,VNS2_HRSVA/1-124);
ATL  0.24214
DNO  2
DLN  372
DID  0.75
DPH  (VNS2_ORSVW/1-124:0.26215,VNS2_HRSVA/1-124:0.05289);
DTP  (VNS2_ORSVW/1-124,VNS2_HRSVA/1-124);
DTL  0.31504
RID  0.830357
RPH  (VNS2_ORSVW/1-124:0.18804,VNS2_HRSVA/1-124:0.05410);
RTP  (VNS2_ORSVW/1-124,VNS2_HRSVA/1-124);
RTL  0.24214
LNK  VNS2_HRSVA/1-124:P04543:U50362
LNK  VNS2_ORSVW/1-124:Q65707:L15451
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VNS2_ORSVW/1-124
ASQ  MSTPNCKITTQRLVVNDMKPLSIETEIISLTKEIITHTFIYLINHECIVRKLNEQQATFTFLVNYEMKLLHKVGSTKYNRYTEYNSKYGTFPMPIFINHAGFLECIGIKPTRNTPVIYKYDLNP
DSQ  ATGAGCACTCCAAACTGCAAAATCACCACTCAGAGACTAGTAGTAAATGACATGAAGCCACTATCTATAGAAACAGAGATAATATCTTTGACAAAAGAGATAATAACACACACATTCATATATCTAATAAACCATGAATGTATAGTGCGCAAACTCAATGAACAACAGGCTACATTTACATTCCTTGTTAATTATGAAATGAAGCTATTACATAAAGTAGGCAGCACAAAGTACAATAGATACACAGAATACAACAGCAAATATGGGACATTTCCAATGCCAATATTTATCAACCATGCTGGTTTTCTAGAATGTATAGGCATTAAGCCTACAAGGAACACTCCTGTAATATACAAGTATGATTTAAATCCA
TRN  10010101110011010
NAM  VNS2_HRSVA/1-124
ASQ  MDTTHNDNTPQRLMITDMRPLSLETIITSLTRDIITHKFIYLINHECIVRKLDERQATFTFLVNYEMKLLHKVGSTKYKKYTEYNTKYGTFPMPIFINHDGFLECIGIKPTKHTPIIYKYDLNP
DSQ  ATGGACACAACCCACAATGATAATACACCACAAAGACTGATGATCACAGACATGAGACCGTTGTCACTTGAGACCATAATAACATCACTAACCAGAGACATCATAACACACAAATTTATATACTTGATAAATCATGAATGCATAGTGAGAAAACTTGATGAAAGACAGGCCACATTTACATTCCTGGTCAACTATGAAATGAAACTATTACACAAAGTAGGAAGCACTAAATATAAAAAATATACTGAATACAACACAAAATATGGCACTTTCCCTATGCCAATATTCATCAATCATGATGGGTTCTTAGAATGCATTGGCATTAAGCCTACAAAGCATACTCCCATAATATACAAGTATGATCTCAATCCA
TRN  10010101100011000
//