EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02975 - Me-amine-dh_L)
FAM  PF02975
PID  Me-amine-dh_L
DES  Methylamine dehydrogenase, L chain
IPR  IPR004229
ANO  2
ALN  123
AID  0.767857
APH  (DHML_PARVE/65-187:0.19240,DHML_METFL/64-185:0.12922);
ATP  (DHML_PARVE/65-187,DHML_METFL/64-185);
ATL  0.32161
DNO  2
DLN  369
DID  0.693989
DPH  (DHML_PARVE/65-187:0.38898,DHML_METFL/64-185:0.01058);
DTP  (DHML_PARVE/65-187,DHML_METFL/64-185);
DTL  0.39957
RID  0.767857
RPH  (DHML_PARVE/65-187:0.11539,DHML_METFL/64-185:0.20622);
RTP  (DHML_PARVE/65-187,DHML_METFL/64-185);
RTL  0.32161
LNK  DHML_METFL/64-185:Q50425:L37427
LNK  DHML_PARVE/65-187:P22641:M58001
AMK  .xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  DHML_PARVE/65-187
ASQ  dPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
DSQ  gatCCGCGCGCCAAGTGGCAGCCGCAGGACAACGACATCCAGGCCTGCGACTACTGGCGGCACTGTTCCATCGACGGCAACATCTGCGACTGCTCGGGCGGGTCGCTGACCAACTGCCCGCCGGGCACCAAGCTGGCGACGGCGTCCTGGGTGGCGAGCTGCTACAACCCGACCGACGGGCAAAGCTACCTGATCGCCTATCGCGACTGCTGCGGCTACAACGTCTCGGGCCGCTGCCCCTGCCTGAACACGGAAGGCGAGCTGCCGGTCTATCGCCCGGAATTCGCCAACGACATCATCTGGTGCTTCGGCGCCGAGGATGACGCGATGACCTATCACTGCACGATCTCTCCCATCGTCGGCAAGGCA
TRN  11011111101111111
NAM  DHML_METFL/64-185
ASQ  .GREGYKPQDKDPKSCDYWRHCSIDGNLCDCCGGSLTSCPPGTELSPSSWVASCFNPGDGQTYLIAYRDCCGKQTCGRCNCVNVQGELPVYRPEFNNDIVWCFGADNDAMTYHCTVSPIVGKA
DSQ  ...GGCAGGGAGGGCTACAAGCCACAGGATAAGGACCCCAAGTCTTGCGATTACTGGCGTCATTGCTCAATTGATGGCAACTTGTGTGACTGCTGCGGTGGTTCTTTGACATCTTGCCCTCCGGGCACAGAGCTGTCGCCAAGTTCATGGGTAGCAAGTTGTTTCAATCCAGGCGACGGTCAAACTTATCTGATAGCGTATCGTGATTGTTGTGGTAAGCAGACTTGTGGTCGTTGCAATTGCGTGAACGTGCAGGGTGAGCTTCCAGTCTATCGACCAGAGTTTAACAACGACATCGTCTGGTGCTTCGGCGCCGACAACGATGCCATGACCTACCATTGCACGGTCTCCCCGATCGTCGGTAAGGCC
TRN  10010101100011001
//