EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02969 - TAF)
FAM  PF02969
PID  TAF
DES  TATA box binding protein associated factor (TAF)
IPR  IPR004823
ANO  12
ALN  68
AID  0.424344
APH  ((((((((O74462_SCHPO/3-68:0.37102,TAF6_YEAST/9-74:0.44051):0.15756,((Q9SLJ8_ARATH/1-64:0.18525,Q8LRG9_ORYSA/1-68:0.11482):0.04384,Q9MAU3_ARATH/1-68:0.14061):0.23951):0.09321,Q8SR29_ENCCU/1-65:0.56533):0.14707,TAF6L_HUMAN/9-73:0.55930):0.04838,Q9GZI6_CAEEL/24-85:1.18613):0.06594,TAF6_DROME/18-83:0.39467):0.29239,TAF6_XENLA/9-74:0.13275):0.02633,TAF6_HUMAN/11-76:0.16691,Q9DDC0_PLEWA/11-76:0.10132);
ATP  ((((((((O74462_SCHPO/3-68,TAF6_YEAST/9-74),((Q9SLJ8_ARATH/1-64,Q8LRG9_ORYSA/1-68),Q9MAU3_ARATH/1-68)),Q8SR29_ENCCU/1-65),TAF6L_HUMAN/9-73),Q9GZI6_CAEEL/24-85),TAF6_DROME/18-83),TAF6_XENLA/9-74),TAF6_HUMAN/11-76,Q9DDC0_PLEWA/11-76);
ATL  5.48579
DNO  12
DLN  204
DID  0.499998
DPH  ((((((TAF6L_HUMAN/9-73:0.37583,TAF6_DROME/18-83:0.26181):0.03784,Q9GZI6_CAEEL/24-85:0.91176):0.08990,(TAF6_HUMAN/11-76:0.11758,(TAF6_XENLA/9-74:0.14541,Q9DDC0_PLEWA/11-76:0.14644):0.03747):0.21178):0.19642,((Q9SLJ8_ARATH/1-64:0.19605,Q9MAU3_ARATH/1-68:0.21778):0.11769,Q8LRG9_ORYSA/1-68:0.11157):0.16225):0.15012,Q8SR29_ENCCU/1-65:0.37214):0.18678,O74462_SCHPO/3-68:0.32141,TAF6_YEAST/9-74:0.32328);
DTP  ((((((TAF6L_HUMAN/9-73,TAF6_DROME/18-83),Q9GZI6_CAEEL/24-85),(TAF6_HUMAN/11-76,(TAF6_XENLA/9-74,Q9DDC0_PLEWA/11-76))),((Q9SLJ8_ARATH/1-64,Q9MAU3_ARATH/1-68),Q8LRG9_ORYSA/1-68)),Q8SR29_ENCCU/1-65),O74462_SCHPO/3-68,TAF6_YEAST/9-74);
DTL  4.69131
RID  0.424344
RPH  ((((((((O74462_SCHPO/3-68:0.37102,TAF6_YEAST/9-74:0.44051):0.15756,((Q9SLJ8_ARATH/1-64:0.18525,Q8LRG9_ORYSA/1-68:0.11482):0.04384,Q9MAU3_ARATH/1-68:0.14061):0.23951):0.09321,Q8SR29_ENCCU/1-65:0.56533):0.14707,TAF6L_HUMAN/9-73:0.55930):0.04838,Q9GZI6_CAEEL/24-85:1.18613):0.06594,TAF6_DROME/18-83:0.39467):0.29239,TAF6_XENLA/9-74:0.13275):0.02633,TAF6_HUMAN/11-76:0.16691,Q9DDC0_PLEWA/11-76:0.10132);
RTP  ((((((((O74462_SCHPO/3-68,TAF6_YEAST/9-74),((Q9SLJ8_ARATH/1-64,Q8LRG9_ORYSA/1-68),Q9MAU3_ARATH/1-68)),Q8SR29_ENCCU/1-65),TAF6L_HUMAN/9-73),Q9GZI6_CAEEL/24-85),TAF6_DROME/18-83),TAF6_XENLA/9-74),TAF6_HUMAN/11-76,Q9DDC0_PLEWA/11-76);
RTL  5.48579
LNK  O74462_SCHPO/3-68:O74462:AL031535
LNK  Q8LRG9_ORYSA/1-68:Q8LRG9:AP003077
LNK  Q8SR29_ENCCU/1-65:Q8SR29:AL590449
LNK  Q9DDC0_PLEWA/11-76:Q9DDC0:AJ293586
LNK  Q9GZI6_CAEEL/24-85:Q9GZI6:AF025469
LNK  Q9MAU3_ARATH/1-68:Q9MAU3:AC004809
LNK  Q9SLJ8_ARATH/1-64:Q9SLJ8:AC005287
LNK  TAF6_DROME/18-83:P49847:AE003516
LNK  TAF6_HUMAN/11-76:P49848:L25444
LNK  TAF6L_HUMAN/9-73:Q9Y6J9:AF069735
LNK  TAF6_XENLA/9-74:Q91857:D50054
LNK  TAF6_YEAST/9-74:P53040:X97644
AMK  .xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xx
DMK  ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxx
NAM  Q8SR29_ENCCU/1-65
ASQ  .MLFSKETLKSFAQSKGISNIDDDALRVLSQDLEYRIKEVCQEGSKFMVGSKRTKLSIDDINYA-.LT
DSQ  ...ATGCTGTTTTCAAAGGAGACTCTCAAGTCTTTTGCACAGTCGAAGGGGATTTCCAACATAGACGACGATGCGCTGAGGGTCTTGTCTCAGGATCTGGAGTACAGGATCAAGGAGGTGTGCCAGGAGGGAAGCAAGTTTATGGTTGGGTCGAAGAGGACAAAGCTGTCTATCGACGACATCAACTACGCC---...CTCACC
TRN  10010101100011001
NAM  Q8LRG9_ORYSA/1-68
ASQ  mSIVPKETIEVIGQSVGIANLPADVSAALAPDVEYRLREIMQEAIKCMRHAKRTVLTADDVDSALsLR
DSQ  atgAGCATAGTGCCCAAAGAGACGATTGAGGTGATCGGGCAGAGCGTCGGCATCGCCAACCTCCCCGCCGATGTCTCCGCCGCGCTCGCCCCCGACGTGGAGTACCGCCTCCGCGAGATCATGCAGGAGGCCATCAAGTGTATGCGGCATGCAAAGAGGACAGTCCTGACTGCCGATGATGTTGATAGTGCTCTCagcCTCAGG
TRN  10010101100011011
NAM  Q9MAU3_ARATH/1-68
ASQ  mSIVPKETVEVIAQSIGITNLLPEAALMLAPDVEYRVREIMQEAIKCMRHSKRTTLTASDVDGALnLR
DSQ  atgAGCATTGTACCTAAGGAAACGGTTGAGGTAATAGCTCAAAGTATTGGGATTACCAACTTGTTACCTGAAGCTGCTCTTATGCTTGCTCCTGATGTTGAGTATCGTGTCCGAGAGATCATGCAGGAAGCTATCAAATGCATGCGTCACTCAAAGAGAACGACTTTAACAGCTTCGGATGTAGATGGTGCTCTCaacTTAAGG
TRN  10010101110011000
NAM  Q9SLJ8_ARATH/1-64
ASQ  .-MVTKESIEVIAQSIGLSTLSPDVSAALAPDVEYRVREVMQEAIKCMRHARRTTLMAHDVDSA-.LH
DSQ  ...---ATGGTGACGAAAGAATCCATTGAAGTGATAGCTCAGAGCATTGGACTCTCCACTCTTTCTCCGGACGTCTCAGCCGCTCTTGCTCCCGATGTCGAGTATCGCGTCCGAGAGGTCATGCAGGAAGCTATCAAATGCATGCGTCATGCTCGACGCACCACTTTAATGGCTCATGATGTCGATTCTGCT---...CTTCAT
TRN  10010101110011000
NAM  TAF6_YEAST/9-74
ASQ  tIWSPQDTVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSKRDVLTTDDVSKA-.LR
DSQ  acaATTTGGTCTCCACAAGATACTGTTAAAGATGTCGCTGAGTCGCTTGGGTTGGAAAATATCAACGATGACGTGTTGAAAGCACTTGCTATGGACGTTGAATACCGTATTCTAGAGATTATTGAACAGGCAGTCAAGTTTAAAAGACACTCTAAAAGAGATGTTTTAACTACAGACGATGTATCGAAGGCC---...CTGCGT
TRN  10010101100011010
NAM  O74462_SCHPO/3-68
ASQ  lTVWNIESIKDVAEMLGIGNLADEPAAAIAMDLEYRIHQVVQEATKFMVHSKRTVLTSADISSA-.LR
DSQ  ttgACAGTATGGAATATTGAATCCATCAAAGATGTTGCTGAAATGCTTGGGATTGGCAATCTTGCCGATGAACCAGCAGCAGCTATTGCAATGGATCTCGAATATAGAATTCATCAGGTGGTTCAGGAAGCCACTAAGTTTATGGTTCATTCTAAAAGAACTGTTTTAACTAGCGCAGATATCTCTTCAGCG---...TTACGG
TRN  10010101110011000
NAM  Q9DDC0_PLEWA/11-76
ASQ  nTLFPTESMKVIAESIGISQVPEETCQLLTEEVSYRIKEITQDALKFMSVGKRQKLTTCDIDSA-.LR
DSQ  aacACCCTCTTCCCCACCGAGTCAATGAAGGTCATTGCTGAATCCATTGGCATCTCGCAGGTACCGGAAGAGACCTGCCAGCTGTTGACTGAGGAAGTCAGCTACCGGATCAAGGAGATCACCCAGGATGCCCTGAAATTCATGAGTGTGGGAAAGAGGCAGAAACTGACAACTTGCGACATTGACTCTGCC---...TTAAGA
TRN  10010101100011000
NAM  TAF6_XENLA/9-74
ASQ  nTLLPSESMKVISESVGISQMSEETCQLLAQEVSFRIKEVTQDALKFMHVGKRQKLTPSDIDAA-.LK
DSQ  aacACTCTTCTCCCCAGTGAGTCCATGAAAGTGATCTCAGAGTCCGTAGGGATCTCCCAGATGTCGGAGGAGACGTGTCAGCTGCTCGCACAGGAGGTCAGCTTCCGGATCAAGGAGGTCACTCAGGATGCCCTGAAGTTCATGCATGTGGGGAAGAGGCAGAAGCTGACACCCAGTGATATTGATGCTGCA---...CTGAAA
TRN  10010101100011001
NAM  TAF6_HUMAN/11-76
ASQ  nTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYA-.LK
DSQ  aacACTGTGCTGCCCTCGGAGTCCATGAAGGTGGTGGCTGAATCCATGGGCATCGCCCAGATTCAGGAGGAGACCTGCCAGCTGCTAACGGATGAGGTCAGCTACCGCATCAAAGAGATCGCACAGGATGCCTTGAAGTTCATGCACATGGGGAAGCGGCAGAAGCTCACCACCAGTGACATTGACTACGCC---...TTGAAG
TRN  11011101101011011
NAM  TAF6_DROME/18-83
ASQ  gSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMS-.LK
DSQ  ggcTCCAGCATCTCGGCGGAGTCCATGAAGGTGATCGCGGAGAGCATCGGAGTGGGCTCCCTGTCGGATGACGCCGCCAAGGAACTAGCGGAGGATGTGTCCATCAAGCTGAAGAGGATTGTACAGGATGCGGCCAAGTTCATGAACCACGCCAAGCGGCAGAAGCTCTCAGTGCGGGACATCGACATGTCC---...CTTAAG
TRN  10010101100011001
NAM  TAF6L_HUMAN/9-73
ASQ  fVEIPRESVRLMAESTGL-ELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRA-.LR
DSQ  tttGTGGAGATCCCTCGGGAGTCTGTCCGGCTCATGGCGGAGAGCACGGGCCTG---GAGCTGAGCGATGAGGTGGCGGCGCTGCTCGCAGAGGACGTGTGCTATCGTCTGAGAGAGGCCACGCAGAATAGCTCTCAGTTCATGAAGCACACCAAACGCCGGAAGCTGACGGTTGAGGACTTCAACAGGGCC---...CTCAGA
TRN  10010101100011011
NAM  Q9GZI6_CAEEL/24-85
ASQ  tPIFTQTA----AEMLGITSLNTEAAELLEFLSREKLKEIVRLSAKWTQKSARRRMAVADVEHA-.IR
DSQ  actCCGATTTTCACACAAACCGCC------------GCTGAAATGCTCGGAATTACCAGCTTGAACACAGAAGCCGCCGAATTATTGGAGTTTTTGTCCCGTGAAAAGCTGAAAGAAATTGTTCGGCTCAGCGCAAAATGGACGCAGAAAAGTGCTCGGCGCCGGATGGCCGTGGCCGATGTGGAACACGCG---...ATCCGA
TRN  11011101101011010
//