EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02941 - FeThRed_A)
FAM  PF02941
PID  FeThRed_A
DES  Ferredoxin thioredoxin reductase variable alpha chain
IPR  IPR004207
ANO  4
ALN  77
AID  0.448641
APH  ((FTRV_SPIOL/95-168:0.62024,FTRV_MAIZE/18-91:0.19500):0.60662,FTRV_SYNY3/3-69:0.13831,FTRV_SYNP6/3-69:0.30918);
ATP  ((FTRV_SPIOL/95-168,FTRV_MAIZE/18-91),FTRV_SYNY3/3-69,FTRV_SYNP6/3-69);
ATL  1.86934
DNO  3
DLN  231
DID  0.509708
DPH  (FTRV_SPIOL/95-168:0.77862,FTRV_SYNP6/3-69:0.35684,FTRV_SYNY3/3-69:0.14144);
DTP  (FTRV_SPIOL/95-168,FTRV_SYNP6/3-69,FTRV_SYNY3/3-69);
DTL  1.2769
RID  0.462315
RPH  (FTRV_SPIOL/95-168:1.10641,FTRV_SYNP6/3-69:0.22573,FTRV_SYNY3/3-69:0.22008);
RTP  (FTRV_SPIOL/95-168,FTRV_SYNP6/3-69,FTRV_SYNY3/3-69);
RTL  1.55222
LNK  FTRV_MAIZE/18-91:P80680:
LNK  FTRV_SPIOL/95-168:P38365:X78880
LNK  FTRV_SYNP6/3-69:P24018:X54196
LNK  FTRV_SYNY3/3-69:Q55781:D64002
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  FTRV_SPIOL/95-168
ASQ  VGCKVKVKSPLKVYHVP--KLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVPDRGS-VKLVVHLKEEE
DSQ  GTTGGATGCAAGGTTAAGGTGAAATCCCCTCTTAAAGTCTACCATGTTCCT------AAATTACCTGAAGTTGAATTAACCCCAGATATGGTTGGGGTTATTAAGCAGTATGTTGGATTCTGGAAAGGGAAATACATTTCCCCTAATTATCCTTTCAAAGTTGAGTACCGCATCGATGTCCCTGACCGTGGTTCT---GTCAAATTAGTTGTTCATCTTAAAGAAGAAGAA
TRN  11011101111011010
NAM  FTRV_MAIZE/18-91
ASQ  IGRRVRVTAPLRVYHVL--KAPDLDIQG-MEGVVKQYVCVWKGKRVTANFPFKVEFELAVEGQPKPVRFFAHLREDE
NAM  FTRV_SYNP6/3-69
ASQ  VGDRVRVKESVVVYHHPDHRNQAFDLKD-AEGEIAAILTEWNGKPISANFPYLVSF--S--NKFR-----AHLRDFE
DSQ  GTTGGCGATCGCGTGCGAGTCAAAGAATCAGTGGTGGTGTATCACCATCCTGATCATCGAAATCAAGCCTTTGACTTAAAAGAC---GCGGAAGGCGAAATTGCAGCGATTCTAACTGAGTGGAATGGTAAGCCCATTAGTGCAAACTTTCCCTATCTCGTGAGCTTT------TCC------AATAAGTTTCGT---------------GCACATTTACGTGACTTCGAG
TRN  11011101111011000
NAM  FTRV_SYNY3/3-69
ASQ  VGDRVRVTSSVVVYHHPEHKKTAFDLQG-MEGEVAAVLTEWQGRPISANLPVLVKF--E--QRFK-----AHFRPDE
DSQ  GTCGGCGATCGTGTTCGAGTCACCTCCTCCGTTGTGGTTTACCACCATCCAGAACATAAAAAAACAGCCTTTGATTTACAAGGT---ATGGAAGGGGAAGTGGCCGCCGTATTGACCGAATGGCAGGGCAGGCCCATCAGCGCTAATTTGCCGGTTTTAGTCAAGTTT------GAA------CAGCGTTTTAAG---------------GCCCATTTCCGTCCGGATGAA
TRN  10110101110011010
//