EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02821 - Staphylokinase)
FAM  PF02821
PID  Staphylokinase
DES  Staphylokinase/Streptokinase family
IPR  IPR004093
ANO  11
ALN  132
AID  0.143
APH  (Q9S6V1_STRSP/157-282:0.99151,(((((Q9S6V1_STRSP/40-154:2.01700,Q9ZFE3_STREQ/38-150:0.00000):2.25604,STRP_STREQ/48-172:3.02088):1.59576,Q53284_STREQ/153-279:0.27030):0.03273,Q57391_STRPY/179-305:0.16739):0.36381,(SAK_STAAU/42-163:0.87238,Q9ZFE2_STREQ/59-187:1.31682):2.79410):0.19746,((Q53284_STREQ/282-399:0.00000,Q9ZFE3_STREQ/280-394:1.99574):3.93297,Q9ZFE3_STREQ/155-279:0.10799):0.53348);
ATP  (Q9S6V1_STRSP/157-282,(((((Q9S6V1_STRSP/40-154,Q9ZFE3_STREQ/38-150),STRP_STREQ/48-172),Q53284_STREQ/153-279),Q57391_STRPY/179-305),(SAK_STAAU/42-163,Q9ZFE2_STREQ/59-187)),((Q53284_STREQ/282-399,Q9ZFE3_STREQ/280-394),Q9ZFE3_STREQ/155-279));
ATL  22.4664
DNO  11
DLN  396
DID  0.338674
DPH  ((((((SAK_STAAU/42-163:0.57995,Q9ZFE2_STREQ/59-187:0.63258):0.42390,(Q9S6V1_STRSP/40-154:0.46060,Q9ZFE3_STREQ/38-150:0.56431):0.42137):0.23024,(Q53284_STREQ/282-399:0.31641,Q9ZFE3_STREQ/280-394:0.84468):0.75522):0.12415,STRP_STREQ/48-172:1.16481):0.34890,(Q9S6V1_STRSP/157-282:0.51648,Q9ZFE3_STREQ/155-279:0.43523):0.16642):0.20406,Q53284_STREQ/153-279:0.16086,Q57391_STRPY/179-305:0.22327);
DTP  ((((((SAK_STAAU/42-163,Q9ZFE2_STREQ/59-187),(Q9S6V1_STRSP/40-154,Q9ZFE3_STREQ/38-150)),(Q53284_STREQ/282-399,Q9ZFE3_STREQ/280-394)),STRP_STREQ/48-172),(Q9S6V1_STRSP/157-282,Q9ZFE3_STREQ/155-279)),Q53284_STREQ/153-279,Q57391_STRPY/179-305);
DTL  8.57344
RID  0.143
RPH  (Q9S6V1_STRSP/157-282:0.99151,(((((Q9S6V1_STRSP/40-154:2.01700,Q9ZFE3_STREQ/38-150:0.00000):2.25604,STRP_STREQ/48-172:3.02088):1.59576,Q53284_STREQ/153-279:0.27030):0.03273,Q57391_STRPY/179-305:0.16739):0.36381,(SAK_STAAU/42-163:0.87238,Q9ZFE2_STREQ/59-187:1.31682):2.79410):0.19746,((Q53284_STREQ/282-399:0.00000,Q9ZFE3_STREQ/280-394:1.99574):3.93297,Q9ZFE3_STREQ/155-279:0.10799):0.53348);
RTP  (Q9S6V1_STRSP/157-282,(((((Q9S6V1_STRSP/40-154,Q9ZFE3_STREQ/38-150),STRP_STREQ/48-172),Q53284_STREQ/153-279),Q57391_STRPY/179-305),(SAK_STAAU/42-163,Q9ZFE2_STREQ/59-187)),((Q53284_STREQ/282-399,Q9ZFE3_STREQ/280-394),Q9ZFE3_STREQ/155-279));
RTL  22.4664
LNK  Q53284_STREQ/153-279:Q53284:S46536
LNK  Q53284_STREQ/282-399:Q53284:S46536
LNK  Q57391_STRPY/179-305:Q57391:M19347
LNK  Q9S6V1_STRSP/157-282:Q9S6V1:AJ312396
LNK  Q9S6V1_STRSP/40-154:Q9S6V1:AJ312396
LNK  Q9ZFE2_STREQ/59-187:Q9ZFE2:AF104301
LNK  Q9ZFE3_STREQ/155-279:Q9ZFE3:AF104300
LNK  Q9ZFE3_STREQ/280-394:Q9ZFE3:AF104300
LNK  Q9ZFE3_STREQ/38-150:Q9ZFE3:AF104300
LNK  SAK_STAAU/42-163:P68802:X00127
LNK  STRP_STREQ/48-172:P00779:K02986
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZFE2_STREQ/59-187
ASQ  SKDYQDTTGLYLMINVNGVDSRHNTLVLPQYQDIKLDYNKTYTKDELLRFVQNVIDA.SMENFKVIDLHEVKLVRTATQEEMSPNTFSTLAENQYNDANQSYLLTGNVLVEPVSK--RNLKEVIKTDKAGKP
DSQ  TCAAAAGATTATCAAGACACCACTGGGCTATATCTTATGATTAATGTAAACGGAGTCGATAGTCGTCACAACACCCTTGTTTTACCTCAATATCAAGATATAAAACTCGACTATAATAAAACTTATACAAAGGATGAATTATTGAGGTTCGTTCAAAACGTCATTGATGCT...TCAATGGAGAATTTTAAAGTTATTGATTTGCATGAAGTAAAGCTTGTTAGAACGGCTACTCAAGAAGAGATGAGTCCCAATACTTTTTCAACGCTAGCTGAAAACCAGTACAATGATGCTAATCAATCTTACCTACTTACCGGTAACGTACTTGTCGAACCTGTTAGTAAA------AGGAACCTTAAAGAAGTGATTAAGACTGACAAGGCAGGCAAGCCA
TRN  10010101110011000
NAM  SAK_STAAU/42-163
ASQ  AS-YFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDAtAYKEFRVVELDPSAKIEVTYYDK--NKKKEETKSFPITEKGFVVPDLSEHIKNPGFN-------LITKVVIEKK
DSQ  GCGAGT---TATTTTGAACCAACAGGCCCGTATTTGATGGTAAATGTGACTGGAGTTGATGGTAAAGGAAATGAATTGCTATCCCCTCATTATGTCGAGTTTCCTATTAAACCTGGGACTACACTTACAAAAGAAAAAATTGAATACTATGTCGAATGGGCATTAGATGCGacaGCATATAAAGAGTTTAGAGTAGTTGAATTAGATCCAAGCGCAAAGATCGAAGTCACTTATTATGATAAG------AATAAGAAAAAAGAAGAAACGAAGTCTTTCCCTATAACAGAAAAAGGTTTTGTTGTCCCAGATTTATCAGAGCATATTAAAAACCCTGGATTCAAC---------------------TTAATTACAAAGGTTGTTATAGAAAAGAAA
TRN  10010101110011000
NAM  Q9ZFE3_STREQ/155-279
ASQ  NPAESVFVDYDIKFMSLSNDAPKPQTLS----LGRKRVGEVISAQELKEKAQELLQK.THPDYTIIDQLETRITHDFAKS--TYFENDNDFNYTIQNRQKIDSNPTKDSYNELKDVNGNRDSISTTYVIVKK
DSQ  AACCCTGCAGAGAGTGTCTTTGTTGATTATGACATTAAATTCATGAGTTTAAGTAATGATGCTCCTAAACCACAAACACTTTCT------------CTAGGAAGAAAACGTGTCGGTGAGGTTATTAGTGCGCAAGAACTCAAAGAAAAAGCACAAGAACTTTTGCAAAAA...ACTCATCCCGATTATACTATCATTGATCAGCTAGAAACCAGGATAACACATGATTTTGCAAAATCA------ACCTACTTTGAAAATGATAACGATTTTAACTATACCATTCAAAATCGACAAAAAATAGACTCAAATCCCACAAAAGACAGCTACAACGAATTAAAGGACGTCAATGGCAACAGAGACAGTATCTCAACAACCTATGTTATCGTCAAAAAA
TRN  10010101110011000
NAM  Q57391_STRPY/179-305
ASQ  NSAERVNVNYEVSFVSETGDLDFTPLLRNQYHLTTLAVGDSLSSQELAAIAQFILSK.KHPDYIITKRDSSIVTHDNDIFR-TILPMDQEFTYHIKDREQAYKANSKTGIEEKTN---NTDLISEKYYVLKK
DSQ  AACTCTGCTGAACGCGTTAACGTCAACTATGAAGTGAGCTTTGTCTCCGAAACAGGAGATTTAGACTTTACACCGTTGTTAAGAAACCAATACCATTTGACCACACTGGCAGTTGGTGACTCTCTTTCATCACAAGAGTTAGCAGCAATTGCCCAATTTATCCTATCAAAA...AAACATCCAGATTATATCATTACAAAACGTGACTCCTCAATCGTCACTCATGACAATGACATTTTCCGT---ACGATTTTACCAATGGATCAAGAGTTTACTTACCATATCAAAGACCGGGAACAAGCTTATAAGGCCAATTCTAAAACAGGTATTGAAGAAAAAACGAAC---------AACACTGACCTTATTTCTGAGAAATATTACGTCCTTAAAAAA
TRN  10010101100011000
NAM  Q53284_STREQ/153-279
ASQ  NQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNK.THPGYTIYERDSSIVTHDNDIFR-TILPMDQEFTYHVKNREQAYEINKKSGLNEEIN---NTDLISEKYYVLKK
DSQ  AATCAAGCGAAATCTGTTGATGTGGAATATACTGTACAGTTTACTCCCTTAAACCCTGATGACGATTTCAGACCAGGTCTCAAAGATACTAAGCTATTGAAAACACTAGCTATCGGTGACACCATCACATCTCAAGAATTACTAGCTCAAGCACAAAGCATTTTAAACAAA...ACCCACCCAGGCTATACGATTTATGAACGTGACTCCTCAATCGTCACTCATGACAATGACATTTTCCGT---ACGATTTTACCAATGGATCAAGAGTTTACTTACCATGTCAAAAATCGGGAACAAGCTTATGAGATCAATAAAAAATCTGGTCTGAATGAAGAAATAAAC---------AACACTGACCTGATCTCTGAGAAATATTACGTCCTTAAAAAA
TRN  10010101100011000
NAM  Q9S6V1_STRSP/157-282
ASQ  HPTETANIEYKVQFATKDGEFHPLPIFVD---YGEKHIGEKLTSDEFRKIAEEKLLQ.SYPDYMIDQKEYTIIKHNSLGQLPRYYSYPDDFSYEIQDRQRIMAKDPKSGKELGET--QSIDNVFEKYLITKK
DSQ  CATCCTACTGAGACTGCTAATATTGAGTATAAAGTTCAATTCGCGACTAAAGATGGGGAATTCCACCCACTACCTATTTTTGTAGAC---------TACGGAGAAAAACATATTGGAGAAAAATTAACCTCTGACGAGTTTCGAAAAATTGCAGAAGAAAAGCTTTTGCAA...AGCTACCCTGACTATATGATTGATCAAAAAGAATATACTATCATTAAACACAATTCTCTTGGTCAACTTCCAAGATATTATTCTTATCCAGATGATTTCAGCTACGAAATTCAAGATAGGCAACGTATCATGGCTAAGGACCCAAAGTCCGGAAAAGAACTCGGTGAAACT------CAAAGTATTGATAATGTTTTTGAGAAATACCTTATTACCAAAAAA
TRN  10010101110011010
NAM  STRP_STREQ/48-172
ASQ  VAGTVEGTNQDISLKFFEIDLTSRPAHGG--KTEQGLSPKSKPFATDSGAMSHKLEK.ADLLKAIQEQLIANVHSNDDYFEVIDFASD----ATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPY
DSQ  GTTGCTGGTACTGTTGAGGGGACGAATCAAGACATTAGTCTTAAATTTTTTGAAATCGATCTAACATCACGACCTGCTCATGGAGGA------AAGACAGAGCAAGGCTTAAGTCCAAAATCAAAACCATTTGCTACTGATAGTGGCGCGATGTCACATAAACTTGAGAAA...GCTGACTTACTAAAGGCTATTCAAGAACAATTGATCGCTAACGTCCACAGTAACGACGACTACTTTGAGGTCATTGATTTTGCAAGCGAT------------GCAACCATTACTGATCGAAACGGCAAGGTCTACTTTGCTGACAAAGATGGTTCGGTAACCTTGCCGACCCAACCTGTCCAAGAATTTTTGCTAAGCGGACATGTGCGCGTTAGACCATAT
TRN  10010101110011000
NAM  Q9ZFE3_STREQ/38-150
ASQ  QIRQKSNIVITVSGLVKDTNEEFHIKYVD-----LDLNSSILQKEQLLQAINYRIKQ.TFENKKLKAVD---FAKDARLT---DWEEN----LYIANPSNGSVDLGKQGIKEYRL---TGHVILEEVEEAPE
DSQ  CAGATTCGTCAAAAAAGCAATATTGTCATAACTGTTAGTGGACTTGTCAAGGACACTAATGAAGAGTTTCACATCAAATATGTCGAC---------------CTTGATTTAAACTCTTCTATTCTACAAAAGGAACAGCTGCTCCAAGCTATTAATTACAGAATTAAACAA...ACCTTTGAAAACAAGAAACTTAAAGCTGTCGAC---------TTTGCCAAGGATGCTCGGCTAACA---------GACTGGGAGGAGAAT------------CTCTATATTGCCAACCCAAGCAATGGATCAGTTGACCTAGGTAAGCAAGGGATTAAAGAATATCGTTTG---------ACTGGACATGTAATCCTAGAAGAAGTGGAAGAAGCTCCTGAG
TRN  10010101100011000
NAM  Q9S6V1_STRSP/40-154
ASQ  PDENKITFAINVDGFVEGSNQEILIRGIH--HVLTDQNQKIVTKAELLDAIRHQMVL.LQLDYSYELVD---FAPDAQLLT---RDRR----LLFANRNFEESVSLEDTIQEYLL----KGHVILRKRVEEP
DSQ  CCCGATGAAAATAAAATAACATTTGCCATAAATGTTGATGGTTTTGTCGAAGGTAGTAATCAAGAAATCCTTATTAGAGGAATTCAT------CATGTTTTAACAGATCAAAACCAAAAGATTGTTACAAAGGCCGAGTTGTTAGACGCTATTAGACATCAAATGGTTCTT...CTACAATTGGATTATTCCTATGAACTAGTCGAC---------TTTGCGCCTGATGCACAATTATTAACA---------CGAGATCGACGG------------CTTTTATTTGCCAATCGAAATTTTGAGGAATCCGTATCACTTGAAGATACTATTCAAGAATACCTTTTA------------AAAGGGCATGTTATTCTCAGAAAACGGGTTGAAGAACCT
TRN  10010101110011000
NAM  Q9ZFE3_STREQ/280-394
ASQ  DRLDSSGNLKKEKVQVKYVDMDTNEVLY---------QQTYHVDGKPSIAFHDGYNR.DTRHNLLSTTLDPYNIYGYSTTG-DITQSRVDDTLVVTVTMFKNPLFQTPYDHYDYV----YH--DGEYYTYEE
DSQ  GACAGATTGGATAGCTCTGGAAATCTAAAAAAAGAAAAGGTTCAAGTTAAGTACGTTGACATGGATACTAATGAAGTTTTATAT---------------------------CAGCAAACCTATCACGTCGACGGCAAACCTTCGATTGCTTTTCACGATGGGTACAATCGA...GACACACGCCATAACCTATTGTCAACAACTTTAGACCCATATAATATTTATGGGTACTCTACAACAGGG---GATATAACCCAATCCAGAGTAGATGATACTCTTGTTGTAACTGTTACCATGTTTAAAAACCCACTGTTCCAGACCCCTTATGATCACTACGACTATGTC------------TATCAC------GATGGTGAGTACTATACCTACGAGGAA
TRN  10010101100011000
NAM  Q53284_STREQ/282-399
ASQ  KPYDPFDRSHLKLFTIKYVDVNTNELLK---------SEQLLTASERNLDFRDLYDP.RDKAKLLYNNLDAFGIMDYTLTG-KVEDNHDDTNRIITVYMGKRPEGENASYHLAYD---KDRYTEEEREVYSY
DSQ  AAGCCGTATGATCCCTTTGATCGCAGTCACTTGAAACTGTTCACCATCAAATACGTTGATGTCAACACCAACGAATTGCTAAAA---------------------------AGCGAGCAGCTCTTAACAGCTAGCGAACGTAACTTAGACTTCAGAGATTTATACGATCCT...CGTGATAAGGCTAAACTACTCTACAACAATCTCGATGCTTTTGGTATTATGGACTATACCTTAACTGGA---AAAGTAGAGGATAATCACGATGACACCAACCGTATCATAACCGTTTATATGGGCAAGCGACCCGAAGGAGAGAATGCTAGCTATCATTTAGCCTATGAT---------AAAGATCGTTATACCGAAGAAGAACGAGAAGTTTACAGCTAC
TRN  10010101100011010
//