EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02674 - Colicin_V)
FAM  PF02674
PID  Colicin_V
DES  Colicin V production protein
IPR  IPR003825
ANO  20
ALN  176
AID  0.20055
APH  ((((((((((Y522_TREPA/5-157:1.33754,O51707_BORBU/8-161:1.17628):0.42918,(((Q9CF35_LACLA/2-173:0.42044,(Q99Y72_STRPY/1-174:0.64610,Q97SG6_STRPN/1-174:0.52523):0.29137):0.46338,(Q9K898_BACHD/1-172:0.49332,P94543_BACSU/1-170:0.54802):0.23666):0.20421,Q99UW3_STAAM/2-172:0.92228):0.77177):0.26723,(Q9ZMP9_HELPJ/3-160:0.80078,Q9PIA4_CAMJE/5-158:0.86054):0.86934):0.24002,(Q9CB95_MYCLE/9-161:1.96558,Q9ZEB2_RICPR/4-158:1.24407):0.56294):0.19858,Q9A7R1_CAUCR/3-155:1.44382):0.22293,(Q9PC37_XYLFA/1-152:1.18350,Q984U9_RHILO/5-157:0.89867):0.00000):0.31919,Q9K0C3_NEIMB/6-157:1.38128):0.14218,Q9FAY5_PSEAE/1-147:0.61873):0.32059,Q9CMV3_PASMU/1-152:0.21922):0.17712,Q9KTA0_VIBCH/3-154:0.32791,CVPA_ECOLI/3-154:0.19156);
ATP  ((((((((((Y522_TREPA/5-157,O51707_BORBU/8-161),(((Q9CF35_LACLA/2-173,(Q99Y72_STRPY/1-174,Q97SG6_STRPN/1-174)),(Q9K898_BACHD/1-172,P94543_BACSU/1-170)),Q99UW3_STAAM/2-172)),(Q9ZMP9_HELPJ/3-160,Q9PIA4_CAMJE/5-158)),(Q9CB95_MYCLE/9-161,Q9ZEB2_RICPR/4-158)),Q9A7R1_CAUCR/3-155),(Q9PC37_XYLFA/1-152,Q984U9_RHILO/5-157)),Q9K0C3_NEIMB/6-157),Q9FAY5_PSEAE/1-147),Q9CMV3_PASMU/1-152),Q9KTA0_VIBCH/3-154,CVPA_ECOLI/3-154);
ATL  23.0733
DNO  20
DLN  528
DID  0.36297
DPH  (((((((((((O51707_BORBU/8-161:0.82918,(Q9ZMP9_HELPJ/3-160:0.60231,Q9PIA4_CAMJE/5-158:0.38179):0.29593):0.09630,Q9ZEB2_RICPR/4-158:0.76676):0.31096,((P94543_BACSU/1-170:0.24698,(Q9K898_BACHD/1-172:0.34681,(((Q99Y72_STRPY/1-174:0.46015,Q97SG6_STRPN/1-174:0.41134):0.14061,Q9CF35_LACLA/2-173:0.33040):0.10107,Q99UW3_STAAM/2-172:0.59361):0.29827):0.16400):0.34877,Y522_TREPA/5-157:0.61997):0.11537):0.22385,Q9CB95_MYCLE/9-161:0.94232):0.06891,Q9A7R1_CAUCR/3-155:0.57798):0.12785,Q984U9_RHILO/5-157:0.39350):0.04617,Q9PC37_XYLFA/1-152:0.72718):0.10321,Q9K0C3_NEIMB/6-157:0.60705):0.10510,Q9FAY5_PSEAE/1-147:0.28500):0.25028,Q9CMV3_PASMU/1-152:0.35956):0.06781,Q9KTA0_VIBCH/3-154:0.31284,CVPA_ECOLI/3-154:0.21511);
DTP  (((((((((((O51707_BORBU/8-161,(Q9ZMP9_HELPJ/3-160,Q9PIA4_CAMJE/5-158)),Q9ZEB2_RICPR/4-158),((P94543_BACSU/1-170,(Q9K898_BACHD/1-172,(((Q99Y72_STRPY/1-174,Q97SG6_STRPN/1-174),Q9CF35_LACLA/2-173),Q99UW3_STAAM/2-172))),Y522_TREPA/5-157)),Q9CB95_MYCLE/9-161),Q9A7R1_CAUCR/3-155),Q984U9_RHILO/5-157),Q9PC37_XYLFA/1-152),Q9K0C3_NEIMB/6-157),Q9FAY5_PSEAE/1-147),Q9CMV3_PASMU/1-152),Q9KTA0_VIBCH/3-154,CVPA_ECOLI/3-154);
DTL  13.017
RID  0.20055
RPH  ((((((((((Y522_TREPA/5-157:1.33754,O51707_BORBU/8-161:1.17628):0.42918,(((Q9CF35_LACLA/2-173:0.42044,(Q99Y72_STRPY/1-174:0.64610,Q97SG6_STRPN/1-174:0.52523):0.29137):0.46338,(Q9K898_BACHD/1-172:0.49332,P94543_BACSU/1-170:0.54802):0.23666):0.20421,Q99UW3_STAAM/2-172:0.92228):0.77177):0.26723,(Q9ZMP9_HELPJ/3-160:0.80078,Q9PIA4_CAMJE/5-158:0.86054):0.86934):0.24002,(Q9CB95_MYCLE/9-161:1.96558,Q9ZEB2_RICPR/4-158:1.24407):0.56294):0.19858,Q9A7R1_CAUCR/3-155:1.44382):0.22293,(Q9PC37_XYLFA/1-152:1.18350,Q984U9_RHILO/5-157:0.89867):0.00000):0.31919,Q9K0C3_NEIMB/6-157:1.38128):0.14218,Q9FAY5_PSEAE/1-147:0.61873):0.32059,Q9CMV3_PASMU/1-152:0.21922):0.17712,Q9KTA0_VIBCH/3-154:0.32791,CVPA_ECOLI/3-154:0.19156);
RTP  ((((((((((Y522_TREPA/5-157,O51707_BORBU/8-161),(((Q9CF35_LACLA/2-173,(Q99Y72_STRPY/1-174,Q97SG6_STRPN/1-174)),(Q9K898_BACHD/1-172,P94543_BACSU/1-170)),Q99UW3_STAAM/2-172)),(Q9ZMP9_HELPJ/3-160,Q9PIA4_CAMJE/5-158)),(Q9CB95_MYCLE/9-161,Q9ZEB2_RICPR/4-158)),Q9A7R1_CAUCR/3-155),(Q9PC37_XYLFA/1-152,Q984U9_RHILO/5-157)),Q9K0C3_NEIMB/6-157),Q9FAY5_PSEAE/1-147),Q9CMV3_PASMU/1-152),Q9KTA0_VIBCH/3-154,CVPA_ECOLI/3-154);
RTL  23.0733
LNK  CVPA_ECOLI/3-154:P08550:J01666
LNK  O51707_BORBU/8-161:O51707:AE001176
LNK  P94543_BACSU/1-170:P94543:Z75208
LNK  Q97SG6_STRPN/1-174:Q97SG6:AE007352
LNK  Q984U9_RHILO/5-157:Q984U9:BA000012
LNK  Q99UW3_STAAM/2-172:Q99UW3:BA000017
LNK  Q99Y72_STRPY/1-174:Q99Y72:AE006610
LNK  Q9A7R1_CAUCR/3-155:Q9A7R1:AE005840
LNK  Q9CB95_MYCLE/9-161:Q9CB95:AL583925
LNK  Q9CF35_LACLA/2-173:Q9CF35:AE006395
LNK  Q9CMV3_PASMU/1-152:Q9CMV3:AE006107
LNK  Q9FAY5_PSEAE/1-147:Q9FAY5:AB031231
LNK  Q9K0C3_NEIMB/6-157:Q9K0C3:AE002423
LNK  Q9K898_BACHD/1-172:Q9K898:BA000004
LNK  Q9KTA0_VIBCH/3-154:Q9KTA0:AE004182
LNK  Q9PC37_XYLFA/1-152:Q9PC37:AE004014
LNK  Q9PIA4_CAMJE/5-158:Q9PIA4:AL139075
LNK  Q9ZEB2_RICPR/4-158:Q9ZEB2:AJ235270
LNK  Q9ZMP9_HELPJ/3-160:Q9ZMP9:AE001455
LNK  Y522_TREPA/5-157:O83534:AE001227
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZEB2_RICPR/4-158
ASQ  FFDITIFAIITLFSFFGLYQGIVGFLTRILGFIASIMLGYFLYPYISAQIVKYIENEVISII---------------------ITSVISYVISLILCVFIVYKFLAIISFMRNGFIDRFLGLLVGFVLGSTISLVLFLITMIFTSENYFQSKSLKDFVISSKQNKYGGVLKFSVTT
DSQ  TTTTTTGATATTACTATTTTTGCTATTATTACTCTCTTCTCATTTTTTGGCTTATATCAAGGTATAGTCGGTTTTTTAACTAGAATACTAGGTTTTATTGCTTCTATAATGTTAGGATATTTCTTATATCCATATATTTCTGCACAAATCGTGAAATATATTGAGAATGAGGTTATAAGCATCATT---------------------------------------------------------------ATTACCAGTGTTATATCTTATGTTATTTCTTTAATTTTATGTGTTTTTATAGTTTATAAATTTCTTGCTATAATTTCGTTTATGCGAAACGGTTTTATTGATAGATTCCTAGGGCTATTAGTAGGATTTGTCTTAGGTAGTACTATATCGTTAGTACTATTTTTGATAACAATGATCTTTACTTCTGAAAATTATTTTCAAAGTAAATCTTTAAAAGACTTTGTAATAAGTAGCAAGCAGAACAAATATGGAGGAGTACTGAAATTTTCTGTTACTACT
TRN  10010101100011000
NAM  Q9CB95_MYCLE/9-161
ASQ  WLDIAVLAVAFIAAISGWRSGALGSLLSLIGVLFGAMAGVLLVPHVVSHISAPRAKLFAALF----------------------LILALVVIGEVVGVVLGRAVRSANRSRTVRLVDSVIGVGVQLIVVLTAAWLLATPLTQSKEQPELAS-AVRGSRALASVNEVAPPWLKTVPK
DSQ  TGGCTGGATATCGCTGTTCTAGCGGTCGCGTTCATCGCTGCCATTTCGGGCTGGCGTTCGGGCGCGTTGGGGTCTCTGCTGTCGTTAATCGGCGTACTGTTCGGCGCAATGGCGGGCGTGCTGCTGGTGCCGCACGTCGTTAGCCACATCAGTGCTCCGCGCGCCAAATTATTCGCCGCCCTTTTT------------------------------------------------------------------CTGATCCTCGCATTGGTTGTGATTGGTGAAGTCGTCGGTGTGGTGCTGGGACGTGCGGTGCGCAGCGCGAACCGCAGCCGGACAGTGCGATTGGTTGACTCGGTCATTGGGGTTGGGGTTCAGCTCATTGTAGTGCTGACCGCGGCTTGGCTGTTGGCGACACCGCTGACCCAGTCGAAAGAGCAGCCAGAGCTGGCCTCC---GCGGTCCGGGGTTCGCGGGCGCTCGCTTCAGTCAATGAGGTCGCGCCACCCTGGCTGAAGACGGTGCCTAAG
TRN  11011101101011000
NAM  O51707_BORBU/8-161
ASQ  KITGIVDILIIIIFTSLGFRGFLRGFIKEISGFAEVFVLILLLYKKTEEFRRFVEPIIELSY--------------------IQALLVFFLLIHIGFLILQSLIESIISQLKLLFFNRILGLVLGLLEAFGIIAIVVYIIHSQQIFKPEYF--LKESKLLDYLNPGINYLFKISKT
DSQ  AAAATAACTGGAATAGTAGACATATTAATAATAATAATTTTTACATCTTTGGGATTTAGAGGATTTTTAAGAGGATTTATTAAAGAAATTAGCGGATTTGCTGAAGTTTTTGTTTTAATCCTACTGCTTTACAAAAAAACTGAAGAATTTAGAAGGTTTGTTGAACCTATTATTGAGCTATCCTAC------------------------------------------------------------ATTCAAGCACTACTTGTATTTTTTTTGCTTATACATATAGGATTTTTAATACTACAATCCCTAATAGAATCAATAATAAGTCAACTTAAATTGCTATTCTTCAATAGAATACTAGGCTTAGTGCTTGGCCTACTTGAAGCTTTTGGAATAATTGCAATCGTGGTTTACATAATACACTCACAACAAATATTTAAACCTGAATATTTC------CTAAAAGAAAGCAAACTACTTGATTATTTAAATCCTGGAATAAACTATCTCTTTAAAATTTCAAAAACA
TRN  10010101100011000
NAM  Y522_TREPA/5-157
ASQ  TLDLILGIIMGIVTVRATMRGFVDEFFSKASILCAAVVAILCHKRLVPLTRVLLGHSILLPC---------------------ITFLITFMGVYCVMLFLRSRMRTYATRDLISGFNQVFGFFFGIIEGSVLLTVILLLLHVQPFVSVSHM--LHESVINTVLSPLVLDGVRYMRL
DSQ  ACCCTGGATCTCATTCTTGGAATCATCATGGGGATAGTGACCGTCCGTGCCACCATGCGCGGGTTTGTCGATGAGTTCTTTTCTAAGGCAAGTATCCTGTGCGCAGCAGTTGTTGCAATACTGTGTCATAAAAGGCTCGTGCCCTTGACACGTGTGTTGTTAGGCCACAGTATTCTGCTTCCGTGT---------------------------------------------------------------ATAACGTTCTTGATTACCTTTATGGGCGTCTATTGCGTTATGCTCTTCCTCCGTTCACGTATGCGCACGTATGCTACGCGCGATCTTATCAGTGGTTTTAATCAGGTGTTTGGCTTTTTTTTCGGGATAATTGAAGGGAGTGTACTACTCACTGTTATCCTTTTGCTTTTACACGTGCAGCCTTTTGTATCTGTTTCGCATATG------TTGCATGAAAGCGTAATTAACACTGTTCTCTCTCCCCTTGTCTTAGATGGCGTTCGCTATATGCGCCTG
TRN  10010101100011000
NAM  Q9A7R1_CAUCR/3-155
ASQ  PFDIIAGLLLLISGVTGWVRGASRELTSALSFIFAAAIALFGLRVTGPLFREMMDPDWAATA---------------------TAILVVFVIVFLIVRLIGGRITASLHDTSAGVLDQAVGAGFGLIRALVILGVFNLLLHLATPPDRMPR--WVEDSIFYPLSEVSGTVLKVFAP
DSQ  CCGTTCGACATCATCGCCGGCCTGCTGCTGCTGATCTCAGGCGTCACGGGCTGGGTGCGCGGCGCATCGCGCGAGCTGACCTCGGCGCTGTCCTTCATCTTCGCCGCCGCCATCGCCCTGTTTGGCCTGCGCGTCACCGGCCCGCTCTTCCGCGAGATGATGGACCCCGACTGGGCGGCGACCGCC---------------------------------------------------------------ACGGCGATCCTGGTCGTCTTCGTTATCGTTTTCCTGATCGTGCGTCTGATCGGCGGGCGGATCACCGCCAGCCTGCACGACACCTCAGCCGGCGTTCTCGACCAGGCGGTCGGCGCCGGCTTCGGCCTGATCCGCGCCCTGGTGATCCTGGGCGTGTTCAATCTTCTTCTGCATCTGGCGACGCCCCCGGACCGCATGCCGCGC------TGGGTCGAGGACTCTATTTTCTATCCGCTGTCGGAAGTCAGCGGCACCGTGCTGAAAGTCTTCGCCCCC
TRN  11011101101011001
NAM  Q984U9_RHILO/5-157
ASQ  LLDGILVGFTLVSAMLAMVRGFSREVLSVVSWAAAAAAAFFFYKPVLPYLKPYIENEKIAMA---------------------ASAGVVFIIALIVVSVITMKLADWIIDSRIGALDRTLGFLYGAARGILVVAVALLFFNWLAGAKAPAW--VTDAKSRPLLESIGAKIENLLPA
DSQ  CTGCTTGACGGAATCCTGGTCGGCTTCACCCTGGTCTCGGCGATGCTCGCCATGGTTCGCGGCTTTTCGCGCGAGGTCCTGTCGGTCGTCTCGTGGGCGGCGGCGGCGGCGGCGGCTTTCTTCTTCTACAAGCCGGTCCTGCCCTATCTGAAGCCTTACATCGAGAATGAAAAGATTGCCATGGCG---------------------------------------------------------------GCCTCCGCCGGCGTCGTCTTCATCATCGCGCTGATCGTCGTCTCGGTCATCACCATGAAGCTCGCCGACTGGATCATCGATTCGCGCATCGGCGCGCTCGACCGCACGCTCGGTTTCCTCTACGGCGCCGCGCGCGGCATCCTGGTCGTCGCGGTGGCGCTTTTGTTCTTCAACTGGCTGGCCGGCGCCAAGGCCCCGGCCTGG------GTGACGGACGCCAAATCACGGCCATTGCTGGAATCGATCGGCGCCAAGATCGAGAACCTGCTGCCCGCC
TRN  11011101101011001
NAM  Q9PC37_XYLFA/1-152
ASQ  MIDLILAIIILVSALLGLLRGFVSIIISTSSWLLASWATFEFGNTASHWLASHGVPSTTEIL---------------------CGYALVFIGTLMTVGAVGMLMHAGINAIRLNNIDRIFGFALGTFRGGFIACVLLLMIG-YTPLAHEPV--WRNSRLVPLLQPGVSWMRAKLPQ
DSQ  ATGATCGATCTGATCCTAGCCATCATCATCTTGGTTTCGGCATTATTGGGCCTATTACGTGGCTTTGTAAGCATTATAATAAGTACATCCTCCTGGCTACTGGCCAGCTGGGCGACATTTGAGTTTGGCAATACAGCGAGTCATTGGCTAGCAAGCCATGGCGTTCCATCGACTACTGAAATATTG---------------------------------------------------------------TGTGGTTATGCGTTGGTGTTCATCGGGACTTTGATGACAGTTGGCGCAGTGGGTATGCTGATGCACGCTGGGATCAACGCAATACGTTTAAACAACATAGACCGCATATTCGGCTTTGCCTTAGGGACATTTCGTGGCGGCTTCATTGCTTGCGTACTGTTACTGATGATTGGC---TACACTCCATTGGCGCATGAACCTGTT------TGGCGCAACTCACGATTGGTACCATTACTGCAACCTGGAGTCTCATGGATGCGTGCTAAGTTGCCGCAG
TRN  10010111100111000
NAM  Q9K0C3_NEIMB/6-157
ASQ  IADLLVSAVIAACIVLSAMRGVIAEAGSMAAWVVSFFFAKLFAASFADLAFASFQPRLFALA---------------------LSFISLFVIACLIQKMLRSLLTSAVSAVGLGFANRILGGVFGALKGVLIVTLLVMLAS-KTDLPDTEE--WRQSYTLPFFVSLSEAVLNHSGG
DSQ  ATTGCCGACCTCCTCGTCTCCGCCGTCATCGCCGCCTGCATCGTGCTATCCGCGATGCGCGGCGTGATTGCGGAGGCAGGCTCAATGGCGGCATGGGTGGTTTCCTTCTTTTTCGCCAAACTCTTTGCCGCCTCCTTCGCCGACCTCGCCTTTGCCTCGTTCCAACCCCGCCTGTTTGCATTGGCT---------------------------------------------------------------CTGTCGTTCATTTCCCTGTTCGTCATTGCCTGTCTGATCCAGAAAATGCTCCGTTCGCTGCTGACCAGCGCAGTTTCGGCGGTCGGTTTGGGCTTTGCCAACCGCATTTTGGGCGGCGTATTCGGTGCATTGAAAGGCGTTTTGATTGTTACCCTGCTGGTCATGCTTGCTTCA---AAAACCGACCTGCCCGATACCGAAGAA------TGGCGGCAATCTTACACACTGCCGTTTTTCGTATCGCTTTCCGAAGCCGTGTTGAACCATAGCGGCGGC
TRN  11011101101011001
NAM  Q9FAY5_PSEAE/1-147
ASQ  -----MVAIIVVSSLISLSRGFVKEALSLLTWIVAGAVAWMFGGALAQHLGEYIQTPSARII---------------------AACALLFIATLLLGALVNYLIGELIRVTGLSGTDRFLGMVFGGARGVLLVVLLVGLLS-LAPVQQDPW--WQQSVLMPHFLMVADWSKNFILG
DSQ  ---------------ATGGTCGCCATCATCGTCGTTTCCAGCCTGATCAGTCTGAGTCGCGGCTTCGTCAAGGAAGCCTTGTCCCTGCTTACCTGGATAGTCGCCGGCGCGGTGGCCTGGATGTTCGGCGGGGCGCTGGCGCAGCACCTGGGCGAATACATCCAGACCCCCTCGGCCCGCATCATC---------------------------------------------------------------GCAGCCTGCGCGCTGCTGTTCATCGCGACCCTGCTGCTCGGGGCGCTGGTCAACTACCTCATCGGCGAACTGATCCGGGTCACCGGCCTCTCCGGCACCGACCGCTTCCTCGGCATGGTCTTCGGCGGTGCGCGCGGCGTACTGCTGGTCGTGCTGCTGGTCGGCCTGCTCAGC---CTGGCCCCGGTACAGCAGGACCCTTGG------TGGCAGCAGTCGGTGCTGATGCCGCATTTCCTGATGGTTGCCGACTGGTCGAAGAACTTCATTCTCGGT
TRN  10010111100111011
NAM  Q9CMV3_PASMU/1-152
ASQ  MIDYIIIAIIAFSIIISLLRGFIREVMSVASWVVAFFVANHFYPYLANYLTQ-IESLYLRNG---------------------TAIAILFVATLIVGGIVNHILGELVDKTGLTGTDRVLGACFGLIRGVLIVAALLFFMDTFTNFSQTVW--WKESKLIPHFGFIVEWFFQQLQA
DSQ  ATGATTGATTATATTATCATCGCCATCATTGCATTTTCGATTATTATCAGTCTATTACGTGGATTTATTCGAGAAGTGATGTCAGTCGCAAGCTGGGTCGTTGCTTTTTTTGTGGCGAATCACTTTTATCCTTATCTCGCTAATTATTTAACCCAA---ATCGAATCCCTTTACTTGCGCAATGGC---------------------------------------------------------------ACGGCAATTGCGATCTTGTTTGTTGCCACATTAATTGTGGGCGGGATTGTAAATCATATTTTGGGTGAGTTAGTGGATAAGACGGGGTTAACCGGGACTGATCGCGTACTAGGTGCCTGTTTTGGACTTATTCGAGGCGTATTGATTGTGGCAGCATTGTTATTCTTTATGGATACCTTTACGAATTTTAGCCAAACTGTTTGG------TGGAAAGAATCAAAACTCATTCCACATTTCGGCTTTATTGTTGAGTGGTTTTTTCAACAGTTACAAGCA
TRN  11011101111011000
NAM  CVPA_ECOLI/3-154
ASQ  WIDYAIIAVIAFSSLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTG-FEDELVRNG---------------------IAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGVCFGALRGVLIVAAILFFLDSFTGVSKSED--WSKSQLIPQFSFIIRCFFDYLQS
DSQ  TGGATTGATTACGCCATAATCGCGGTGATTGCTTTTTCCTCTCTGGTTAGCCTGATCCGCGGCTTTGTTCGTGAAGCGTTATCGCTGGTGACATGGGGTTGTGCTTTCTTTGTTGCCAGTCATTACTACACTTACCTGTCAGTCTGGTTTACGGGC---TTTGAAGACGAACTGGTTCGAAATGGG---------------------------------------------------------------ATTGCCATCGCGGTACTGTTTATCGCTACCCTGATCGTTGGTGCTATCGTGAACTTCGTGATAGGCCAGTTGGTGGAGAAAACGGGGTTGTCAGGCACCGATCGGGTGCTGGGCGTCTGTTTCGGTGCGTTGCGCGGTGTGTTGATTGTTGCTGCCATTCTCTTCTTTCTCGACTCCTTTACCGGGGTGTCGAAAAGCGAAGAC------TGGAGCAAATCACAGCTGATCCCGCAATTCAGTTTTATCATCAGATGTTTTTTTGATTATCTGCAAAGC
TRN  10010101100011000
NAM  Q9KTA0_VIBCH/3-154
ASQ  WLDIVILSVIGLSALISLVRGFAKEALSLVIWFGAFYIASEYYAKLAVYFTN-IKDDMFRNG---------------------AAIAALFVATLIVGAIVNYVIAQLVEKTGLSGTDRILGVVFGALRGVLIVAAGLFFMDAFTAFPNTEW--WKSSQLVPEFSRVIAPFFEHLKA
DSQ  TGGTTAGATATTGTCATTTTAAGTGTGATCGGCTTGTCTGCGCTGATCAGTCTTGTTCGCGGCTTTGCCAAAGAAGCCTTGTCTTTAGTGATTTGGTTTGGGGCGTTTTATATCGCTTCGGAGTACTACGCCAAACTGGCGGTGTATTTCACCAAC---ATTAAAGATGACATGTTTCGCAATGGA---------------------------------------------------------------GCGGCGATTGCGGCTCTGTTTGTGGCGACATTGATCGTCGGTGCTATCGTTAACTACGTGATTGCCCAACTGGTCGAAAAAACAGGACTCTCAGGAACCGACAGAATTCTCGGTGTGGTGTTTGGTGCACTACGTGGAGTGTTGATTGTCGCAGCAGGTCTGTTCTTCATGGATGCGTTTACCGCATTTCCAAATACAGAGTGG------TGGAAAAGCTCGCAGCTAGTGCCTGAATTCAGTCGCGTTATTGCTCCGTTCTTTGAACACCTAAAAGCA
TRN  10010101100011000
NAM  Q9PIA4_CAMJE/5-158
ASQ  WFDAFILGFTLLLGLKGIINGLIKEIFGLLGIIGGVFIASKYATQAAEFIQSTFYKIENQSLAG------------------FAGFLAILIIFWIACLLAGNFLSKLIKLSGLGFLDRIGGFIFGGAKIFLIFAILVFCVARIDFLNDKLDNFAKNSYTLNLLKETGSFIMN----
DSQ  TGGTTTGATGCTTTTATTTTAGGATTTACCTTGCTTTTAGGGCTTAAGGGTATTATCAATGGTTTGATAAAAGAAATTTTTGGGCTTTTGGGTATTATTGGTGGTGTTTTTATTGCTTCAAAATATGCAACTCAAGCAGCTGAATTTATACAAAGTACTTTTTATAAGATAGAAAATCAAAGCTTAGCTGGA------------------------------------------------------TTTGCTGGATTTTTGGCCATATTAATTATTTTTTGGATAGCTTGTTTGTTGGCAGGTAATTTTCTTTCTAAGTTGATTAAATTAAGTGGCCTAGGTTTTTTAGATCGTATTGGTGGCTTTATATTTGGCGGGGCAAAAATCTTTTTAATTTTTGCAATTTTAGTTTTTTGTGTAGCAAGAATCGATTTTTTAAATGATAAATTAGATAATTTTGCTAAAAATAGCTATACTTTGAATTTGCTTAAAGAAACTGGATCTTTTATTATGAAT------------
TRN  10010101110011000
NAM  Q9ZMP9_HELPJ/3-160
ASQ  YIDLALLVVVVAFGIRGFYHGFVSEIAATLGIVLGVYLASRYSVAVGNLFSEHLYDLRNETMTN------------------LIGFLLVLASIWVFFLALGVLLGKMLVFSGLGIIDKALGFIFSCLKTFLVLSFILYALSKMDLMKDANAYLQEKSAIFPTMKSVASKIMRLDGV
DSQ  TATATTGATTTGGCGTTACTTGTGGTAGTGGTAGCCTTTGGGATTAGGGGGTTTTATCATGGCTTCGTGAGTGAAATAGCAGCGACTTTGGGGATTGTGCTTGGCGTTTATTTGGCGTCTCGCTATTCTGTGGCTGTTGGGAATTTATTTTCAGAGCATTTGTATGATTTAAGAAATGAAACCATGACCAAT------------------------------------------------------CTCATTGGTTTTTTACTGGTGTTGGCGTCCATTTGGGTGTTTTTTTTAGCTCTTGGAGTGTTGCTAGGCAAGATGTTAGTCTTTAGCGGTCTAGGCATTATAGACAAGGCGTTAGGGTTTATTTTTTCATGTTTGAAGACTTTTTTAGTGCTTTCTTTCATCCTTTATGCGCTCTCTAAAATGGATTTAATGAAAGACGCTAACGCCTATTTGCAAGAAAAGAGCGCTATTTTCCCCACCATGAAAAGCGTCGCTAGTAAGATCATGCGCCTTGATGGCGTC
TRN  10010101100011000
NAM  Q99UW3_STAAM/2-172
ASQ  VIDFIIIIFFVYFVIVGFRRGFWLSMIHLSATIVSLWIASQFYKSIVERLIVFIPYPKTTAFNTTFAFHFN---HLQNRFEAIVAFLMITLFCKFILYLIIVTFDKIIAYQNIHIFSRAMGMIVGVFMTIIVLHFTLYLLALYPNEALQHQ--LKISIVSHSLIFHIPYLSAFTIN
DSQ  GTCATTGATTTTATCATAATCATTTTCTTTGTGTATTTTGTCATCGTTGGATTCAGACGAGGTTTTTGGTTATCTATGATACATTTGAGTGCAACGATTGTATCATTGTGGATTGCCAGTCAATTTTACAAATCTATTGTAGAAAGATTAATTGTATTTATTCCATATCCTAAAACAACAGCATTTAATACAACTTTTGCGTTTCATTTTAAT---------CATCTACAAAATCGATTTGAAGCGATTGTAGCTTTTTTAATGATTACATTGTTTTGTAAGTTCATTTTATATCTAATTATCGTAACTTTTGATAAAATAATAGCGTATCAAAACATTCATATTTTCAGTCGTGCAATGGGAATGATAGTTGGTGTGTTTATGACGATAATTGTCTTACACTTTACGTTATATCTATTGGCATTATATCCTAACGAAGCATTACAACATCAG------CTTAAAATATCTATTGTGAGTCATTCATTGATTTTTCACATCCCATATTTATCGGCTTTCACCATTAAT
TRN  10010101110011000
NAM  P94543_BACSU/1-170
ASQ  MLDIIILILLLMGTLLGLKRGFILQFIRLTSFILSIAFAALFYKNVAPHLH-WIPAPDFSAGQPALSF--FTG-NLEAAYYNAIAFIVLFIIAKILLRIIGSFLSIVAGIPVIKQINQMLGAVLGFLEVYLFTFVLLYVASVLPVDALQQM--MGQSSLANVIINHTPYLSGLLQE
DSQ  ATGCTAGATATCATCATCTTAATCTTGCTCCTGATGGGGACTTTACTGGGGTTAAAACGCGGTTTTATCCTGCAGTTTATCCGCTTGACGAGCTTTATTTTATCAATTGCCTTTGCGGCTTTATTCTATAAAAACGTGGCACCGCATTTACAT---TGGATTCCCGCACCCGATTTTTCAGCGGGACAGCCGGCTCTTTCTTTT------TTTACGGGG---AATTTGGAAGCAGCGTACTATAATGCGATTGCGTTTATCGTTTTATTTATCATTGCTAAAATCTTACTGAGAATCATCGGCTCGTTCCTGAGTATTGTAGCCGGCATTCCGGTGATTAAACAAATCAACCAGATGCTGGGAGCCGTTCTCGGTTTTCTAGAAGTCTATTTATTTACATTTGTGCTGCTGTATGTCGCATCCGTTCTGCCGGTAGACGCGTTGCAGCAAATG------ATGGGGCAATCGTCTCTCGCAAATGTGATCATTAACCATACACCGTACTTGTCAGGGCTTTTACAAGAG
TRN  10010101100011000
NAM  Q9K898_BACHD/1-172
ASQ  MLSVILLFILLCSFFIGKRRGLILQLVHLLGFVAAFFVAYKYYAPVATYIRLWIPYPQFSPDSPVTML--IEAFNFENVYYSGIAFALLFIGTKILLHIVGSMLDFLTHLPILRSVNGWLGGILGFVEVYLIMFVLLYVGALLPIETVQTH--LNQSLVAQFIMNHTPFLSEFIRN
DSQ  ATGCTTAGTGTGATTTTATTGTTTATTTTGCTATGTAGCTTTTTTATCGGAAAGCGGAGGGGATTGATTTTACAGCTCGTACATCTCCTCGGCTTCGTTGCTGCGTTTTTTGTAGCTTACAAATACTATGCTCCAGTTGCTACCTACATTCGTTTATGGATTCCATACCCTCAATTTTCACCAGACAGCCCTGTGACGATGTTG------ATTGAAGCGTTTAACTTTGAAAATGTCTATTATTCTGGAATTGCGTTTGCCCTTCTTTTCATTGGAACAAAGATATTATTGCACATCGTCGGCTCGATGCTTGACTTTTTAACCCATTTGCCGATATTGCGCTCGGTTAACGGGTGGCTCGGGGGCATTCTCGGATTTGTTGAAGTGTATTTAATTATGTTTGTTCTCCTCTATGTTGGTGCATTGCTGCCGATCGAGACGGTGCAAACTCAT------TTAAACCAGTCGTTAGTCGCACAGTTTATCATGAACCATACACCATTTTTATCTGAGTTTATTCGCAAC
TRN  10010101100011000
NAM  Q97SG6_STRPN/1-174
ASQ  MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKGLGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLLHLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNP--LEKSIVAKHIIQSIPVTTSWLKQ
DSQ  ATGATTTCATTCCTTCTTCTATTGGTCTTGGTTTGGGGATTTTATATCGGCTATCGGAGAGGCCTGCTCTTACAGGTTTATTACCTGATTTCAGCCATGGCATCGGCTTTTATGGCTGGCCAGTTTTATAAGGGGCTTGGAGAGCAATTCCATTTATTGCTCCCTTATGCAAATTCGCAGGAAGGTCAGGGGACTTTCTTTTTCCCATCGGATCAACTCTTTCAGCTGGATAAGGTCTTTTATGCAGGTATCGGCTACTTGCTTGTATTTGGGATTGTCTATAGCATTGGTCGTTTACTTGGTCTTCTCTTACACTTGATTCCTAGCAAAAAACTGGGTGGTAAGTTGTTCCAAGTTTCAGCAGGTATCTTGTCCATGTTGGTGACCTTATTTGTCTTGCAAATGGCCTTGACAATCTTGGCGACCATCCCCATGGCAGTTATACAAAATCCT------CTTGAAAAGAGTATCGTCGCAAAACACATCATCCAGAGCATACCGGTAACAACCAGTTGGCTCAAACAA
TRN  10010101100011000
NAM  Q99Y72_STRPY/1-174
ASQ  MLSLLIVLILTWNFYIGYSRGIILQSFYVLGALLSLLVANRFYIGLAHKLTLWIPYSNPVEGTSVFFFKSVDIFVLDKVYYAGLAFFIIFLLGYALSRFLGIFVHFLLLNYFDNQWTKCLSGGLAFLVSLLFLNMLLSIFATVPMPFLQHY--LHSSFLARLVIEHLPPLTIIIQK
DSQ  ATGTTATCTTTATTGATAGTGCTTATTTTAACTTGGAATTTTTATATTGGTTATAGTAGAGGTATTATTCTTCAATCGTTTTATGTCTTAGGAGCCCTACTTTCTCTTTTGGTAGCTAATCGATTTTATATTGGATTAGCCCATAAGCTAACGCTTTGGATTCCTTATTCTAACCCGGTAGAAGGAACATCAGTCTTTTTCTTTAAATCAGTTGATATCTTTGTTTTAGATAAGGTTTATTATGCAGGCCTTGCCTTTTTTATCATTTTCTTATTGGGGTATGCATTGAGTCGCTTTCTTGGGATTTTTGTTCATTTCCTTTTGCTAAATTATTTTGATAACCAGTGGACAAAATGTTTGAGTGGCGGACTAGCGTTTCTAGTATCGCTTCTTTTTTTGAACATGTTACTGTCTATTTTTGCAACGGTCCCTATGCCTTTTTTACAGCACTAT------TTGCACTCTAGTTTTCTTGCTCGTTTGGTGATCGAACACCTTCCACCATTGACAATAATTATTCAAAAA
TRN  10010101100011000
NAM  Q9CF35_LACLA/2-173
ASQ  ILNLIILVALVWAFMVGYSRGLILQVIYSFGTIIAAFIAASNYKELAQKLSIWVPFSNATENSHLLLFSDKLLFQLDDAFYASISFLAIFIVVYAIIRLIGLFLHFALS-P-LGRNGKIIAGILGFAATYFGLQMVLMVLSLVPIAAVQSQ--LDASFLARFMVLHTPISSGILQN
DSQ  ATATTAAATTTGATTATTTTAGTAGCCTTGGTTTGGGCTTTCATGGTTGGTTACTCACGAGGCTTGATTTTACAAGTCATCTACAGTTTTGGTACGATTATTGCGGCCTTCATTGCAGCCAGTAATTATAAAGAGTTAGCACAAAAATTGAGTATTTGGGTTCCTTTTTCAAATGCCACAGAAAACTCACATCTCTTACTTTTTAGTGATAAGCTTCTTTTTCAACTCGATGATGCTTTTTATGCGAGCATTTCGTTTTTAGCAATTTTTATTGTCGTTTATGCTATTATCCGTCTTATCGGTTTATTTTTACATTTTGCACTTAGT---CCT---CTGGGAAGAAATGGAAAAATCATTGCTGGAATTTTAGGATTTGCGGCGACTTATTTTGGTTTACAAATGGTCTTGATGGTCTTGAGTTTGGTTCCTATTGCAGCGGTTCAAAGTCAA------CTTGATGCTAGTTTTCTAGCTCGTTTTATGGTTTTACATACACCGATTTCATCAGGAATCTTGCAAAAC
TRN  10010101100011000
//