EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02609 - Exonuc_VII_S)
FAM  PF02609
PID  Exonuc_VII_S
DES  Exonuclease VII small subunit
IPR  IPR003761
ANO  20
ALN  65
AID  0.386857
APH  ((((((((EX7S_BACHD/9-72:0.24876,EX7S_BACSU/1-64:0.22090):0.00000,EX7S_NEIMA/7-67:0.96313):0.28046,(EX7S_STRR6/5-68:0.26973,EX7S_STRPY/5-68:0.05400):0.39377):0.09784,(EX7S_THEMA/1-64:0.52866,EX7S_STAAW/6-69:0.47155):0.10935):0.16158,(EX7S_RICPR/13-74:0.63679,(EX7S_ZYMMO/10-74:0.40773,(EX7S_RHILO/12-76:0.38276,EX7S_CAUCR/14-77:0.32387):0.11001):0.12392):0.22653):0.14027,(((EX7S_VIBCH/9-71:0.36722,(EX7S_HAEIN/9-71:0.16225,EX7S_PASMU/11-73:0.19546):0.17686):0.13096,EX7S_ECOLI/8-70:0.03717):0.15743,(EX7S_PSEAE/9-69:0.25932,EX7S_XYLFA/13-75:0.66998):0.29962):0.23449):0.84990,EX7S_STRCO/15-78:0.39024):0.37329,EX7S_MYCLE/15-78:0.12046,EX7S_MYCTU/22-85:0.17043);
ATP  ((((((((EX7S_BACHD/9-72,EX7S_BACSU/1-64),EX7S_NEIMA/7-67),(EX7S_STRR6/5-68,EX7S_STRPY/5-68)),(EX7S_THEMA/1-64,EX7S_STAAW/6-69)),(EX7S_RICPR/13-74,(EX7S_ZYMMO/10-74,(EX7S_RHILO/12-76,EX7S_CAUCR/14-77)))),(((EX7S_VIBCH/9-71,(EX7S_HAEIN/9-71,EX7S_PASMU/11-73)),EX7S_ECOLI/8-70),(EX7S_PSEAE/9-69,EX7S_XYLFA/13-75))),EX7S_STRCO/15-78),EX7S_MYCLE/15-78,EX7S_MYCTU/22-85);
ATL  10.8241
DNO  16
DLN  195
DID  0.469381
DPH  (EX7S_NEIMA/7-67:0.38944,(EX7S_BACHD/9-72:0.24828,((EX7S_STRR6/5-68:0.22501,EX7S_STRPY/5-68:0.21552):0.19402,(EX7S_STAAW/6-69:0.29212,EX7S_RICPR/13-74:0.46631):0.13066):0.17360):0.21051,((((EX7S_ECOLI/8-70:0.07476,(EX7S_HAEIN/9-71:0.18684,EX7S_PASMU/11-73:0.15134):0.33188):0.16083,EX7S_VIBCH/9-71:0.33790):0.11915,(EX7S_PSEAE/9-69:0.22510,EX7S_XYLFA/13-75:0.42484):0.06838):0.15442,((EX7S_ZYMMO/10-74:0.39767,EX7S_CAUCR/14-77:0.28595):0.17277,(EX7S_MYCTU/22-85:0.40373,EX7S_STRCO/15-78:0.20301):0.19465):0.18267):0.09861);
DTP  (EX7S_NEIMA/7-67,(EX7S_BACHD/9-72,((EX7S_STRR6/5-68,EX7S_STRPY/5-68),(EX7S_STAAW/6-69,EX7S_RICPR/13-74))),((((EX7S_ECOLI/8-70,(EX7S_HAEIN/9-71,EX7S_PASMU/11-73)),EX7S_VIBCH/9-71),(EX7S_PSEAE/9-69,EX7S_XYLFA/13-75)),((EX7S_ZYMMO/10-74,EX7S_CAUCR/14-77),(EX7S_MYCTU/22-85,EX7S_STRCO/15-78))));
DTL  6.71997
RID  0.388807
RPH  ((((EX7S_STAAW/6-69:0.53223,((EX7S_BACHD/9-72:0.26131,EX7S_NEIMA/7-67:0.77129):0.20922,(EX7S_STRR6/5-68:0.25358,EX7S_STRPY/5-68:0.07325):0.40301):0.11147):0.10783,(((EX7S_VIBCH/9-71:0.38128,(EX7S_HAEIN/9-71:0.15323,EX7S_PASMU/11-73:0.20622):0.18041):0.16272,EX7S_ECOLI/8-70:0.00000):0.22706,(EX7S_PSEAE/9-69:0.23531,EX7S_XYLFA/13-75:0.68716):0.26950):0.39969):0.34006,((EX7S_RICPR/13-74:0.60989,EX7S_CAUCR/14-77:0.24901):0.23242,EX7S_ZYMMO/10-74:0.28875):0.08215):0.79924,EX7S_MYCTU/22-85:0.59296,EX7S_STRCO/15-78:0.32160);
RTP  ((((EX7S_STAAW/6-69,((EX7S_BACHD/9-72,EX7S_NEIMA/7-67),(EX7S_STRR6/5-68,EX7S_STRPY/5-68))),(((EX7S_VIBCH/9-71,(EX7S_HAEIN/9-71,EX7S_PASMU/11-73)),EX7S_ECOLI/8-70),(EX7S_PSEAE/9-69,EX7S_XYLFA/13-75))),((EX7S_RICPR/13-74,EX7S_CAUCR/14-77),EX7S_ZYMMO/10-74)),EX7S_MYCTU/22-85,EX7S_STRCO/15-78);
RTL  9.18353
LNK  EX7S_BACHD/9-72:Q9K968:AP001516
LNK  EX7S_BACSU/1-64:P54522:
LNK  EX7S_CAUCR/14-77:Q9A6M3:AE005880
LNK  EX7S_ECOLI/8-70:P22938:D00694
LNK  EX7S_HAEIN/9-71:P43914:U32822
LNK  EX7S_MYCLE/15-78:Q9X784:
LNK  EX7S_MYCTU/22-85:P67456:BX842575
LNK  EX7S_NEIMA/7-67:Q9JSM1:AL162758
LNK  EX7S_PASMU/11-73:Q9CNA0:AE006088
LNK  EX7S_PSEAE/9-69:Q9HWY5:AE004821
LNK  EX7S_RHILO/12-76:Q985Y6:
LNK  EX7S_RICPR/13-74:Q9ZDH8:AJ235271
LNK  EX7S_STAAW/6-69:P67462:AP004827
LNK  EX7S_STRCO/15-78:Q9FBM4:AL939122
LNK  EX7S_STRPY/5-68:P67467:AE006583
LNK  EX7S_STRR6/5-68:P67466:AE008481
LNK  EX7S_THEMA/1-64:Q9X290:
LNK  EX7S_VIBCH/9-71:Q9KTL1:AE004173
LNK  EX7S_XYLFA/13-75:Q9PFJ7:AE003910
LNK  EX7S_ZYMMO/10-74:Q9RME6:AF203881
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  EX7S_STRCO/15-78
ASQ  LGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAEVCRRRLDGARARLD-AALAEEADPED
DSQ  CTCGGGTACGAGCAGGCGCGGGACGAGCTGATCGAGGTCGTCCGGCGGCTGGAGGCCGGCGGTACGACGCTGGAGGAGTCCCTCGCCCTGTGGGAGCGGGGCGAGGAGCTGGCGGAGGTGTGCCGCCGCCGGCTGGACGGCGCGCGGGCCCGCCTGGAC---GCGGCGCTGGCCGAGGAGGCGGACCCGGAGGAC
TRN  11011111101111111
NAM  EX7S_MYCTU/22-85
ASQ  LGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVS-DVLAGDEAQNG
DSQ  CTTGGCTATGAAGCCTGCCGGGACGAGCTGATGGAAGTCGTGCGGCTTCTGGAGCAGGGCGGATTGGACCTCGATGCGTCGCTGCGACTGTGGGAAAGAGGGGAGCAACTCGCCAAAAGGTGCGAGGAGCACTTAGCTGGTGCACGCCAGCGGGTGTCC---GATGTGCTGGCCGGCGACGAGGCCCAAAACGGC
TRN  10010101100011010
NAM  EX7S_MYCLE/15-78
ASQ  LGYEACRDELIEVVRLLEQGGLNLDMSLKLWERGEQLAKRCEEHLDGARQRVA-DVLSARQVEEA
NAM  EX7S_CAUCR/14-77
ASQ  LSFEEALSQLERIVQELESGQAALERSIDIYERGAALKAHCEKKLEAARLKVEKIVLGQGG-AVA
DSQ  CTCAGCTTCGAGGAAGCGCTGTCGCAGCTGGAGCGCATCGTGCAGGAGCTGGAGTCGGGCCAGGCCGCTCTCGAGCGCTCGATCGACATCTACGAGCGCGGCGCGGCCTTGAAGGCGCACTGCGAGAAGAAGCTCGAGGCCGCGCGCCTGAAGGTCGAAAAGATCGTGCTGGGGCAGGGCGGC---GCGGTGGCC
TRN  11011111101111111
NAM  EX7S_RHILO/12-76
ASQ  MSFEQALDALEKIVDDLERGDVPLDQSIRIYERGEALKAHCDRLLKAAEDKVEKIRLSRDGKPVG
NAM  EX7S_ZYMMO/10-74
ASQ  LSFEEALKKLEEIVRRLESGDTTLEDSIQMYSQGDALKKQCEARLKAAQKKIEQISLDQDGRATG
DSQ  CTGAGCTTCGAAGAAGCCTTGAAAAAGCTCGAAGAGATTGTCCGCCGCCTCGAAAGCGGGGATACAACCCTCGAAGACTCTATCCAGATGTATAGTCAGGGCGATGCATTGAAAAAACAATGCGAAGCACGGCTGAAAGCGGCACAGAAAAAAATCGAACAGATCAGTCTCGATCAGGACGGAAGGGCAACAGGA
TRN  10010101100011011
NAM  EX7S_RICPR/13-74
ASQ  --FEEALRELEEIVKKIDTGQENLETAVNSFERGILLKNHCEKKLKEARLKIEKITKLADS-TVI
DSQ  ------TTTGAAGAAGCTTTAAGAGAGCTTGAGGAAATTGTAAAAAAAATAGATACTGGACAAGAGAATCTAGAGACGGCAGTTAATAGTTTTGAAAGGGGTATTTTACTTAAGAATCATTGTGAAAAAAAATTAAAAGAAGCTCGATTAAAAATTGAAAAAATTACTAAACTTGCTGATTCT---ACAGTGATC
TRN  10010101110011010
NAM  EX7S_STAAW/6-69
ASQ  QSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVN-DLIKEEAEDVK
DSQ  CAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAAAAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATGAAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAAT---GACTTAATAAAAGAAGAAGCTGAGGATGTAAAA
TRN  10010101110011000
NAM  EX7S_THEMA/1-64
ASQ  MNFEEMMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNRLKII-DVMKELEGEID
NAM  EX7S_NEIMA/7-67
ASQ  KSFEEALSRLESLTQAMQ-GEMPLEDALAAYQEGNELVIYCQTKLAQVEQKL--QVLDADG-LKE
DSQ  AAATCGTTTGAAGAAGCCTTGTCGCGCCTTGAATCGCTGACACAAGCTATGCAG---GGCGAAATGCCCTTGGAAGACGCGCTTGCCGCCTATCAGGAAGGCAACGAGCTGGTCATATACTGCCAAACCAAGCTGGCGCAAGTCGAACAGAAATTA------CAGGTTTTGGATGCGGACGGG---CTGAAGGAG
TRN  10010101100011010
NAM  EX7S_STRPY/5-68
ASQ  KTFEENLQDLETIVNKLENGDVPLEEAISEFQKGMLLSKELQKTLQAAEKTLV-KVMQADGTEVD
DSQ  AAAACATTTGAAGAAAATTTACAAGATTTAGAGACTATTGTGAACAAACTTGAAAATGGGGATGTCCCTTTGGAAGAAGCTATTTCAGAATTTCAAAAAGGAATGCTTCTCTCAAAAGAACTTCAAAAGACCTTACAAGCGGCAGAAAAAACACTCGTC---AAAGTGATGCAAGCTGATGGCACAGAAGTAGAT
TRN  11011101111011000
NAM  EX7S_STRR6/5-68
ASQ  KKFEENLAELETIVQSLENGEIALEDAITAFQKGMVLSKELQATLDKAEKTLV-KVMQEDGTESD
DSQ  AAGAAATTTGAGGAAAATCTAGCAGAACTGGAAACCATTGTCCAAAGTTTGGAAAATGGTGAAATTGCTCTGGAAGATGCGATTACTGCCTTTCAAAAGGGCATGGTCTTGTCAAAAGAGCTCCAAGCTACGCTGGACAAGGCTGAAAAGACCTTGGTC---AAGGTCATGCAAGAAGACGGAACAGAAAGTGAT
TRN  11011101101011001
NAM  EX7S_BACSU/1-64
ASQ  MTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMALSKMCHEKLQKVEKQMD-FILKEDGELAP
NAM  EX7S_BACHD/9-72
ASQ  LSFEEAMEQLEEVVEQLEQGDVPLEEAISMFQKGMNLSKVCHEKLATVEKQMD-QILKEDGNFEE
DSQ  CTCAGTTTTGAAGAGGCGATGGAGCAGCTTGAAGAAGTGGTAGAACAGCTTGAACAAGGGGACGTGCCGCTAGAGGAAGCCATTTCGATGTTCCAAAAAGGGATGAACCTCTCGAAGGTTTGTCATGAAAAGCTGGCAACTGTAGAGAAGCAGATGGAT---CAGATATTGAAAGAAGATGGGAATTTTGAGGAA
TRN  10010101100011011
NAM  EX7S_XYLFA/13-75
ASQ  ARFEQSLQELEQLVQNMETGALSLEQSLGAYERGIALYRECHQALEQAQLRVR--LLSDPMHPDD
DSQ  GCCCGCTTTGAACAGTCCCTTCAAGAACTGGAGCAACTGGTACAGAACATGGAAACCGGAGCACTGAGCTTGGAACAGTCCCTTGGCGCCTACGAACGCGGTATCGCCCTGTATCGTGAATGCCATCAAGCCCTGGAACAGGCGCAATTGCGCGTCCGG------CTATTGAGCGATCCAATGCACCCAGATGAC
TRN  11011111101111111
NAM  EX7S_PSEAE/9-69
ASQ  --FEQSLTELQTLVERLESGELSLEESLGAFEQGIRLTRECQTSLSQAEQKVQ--ILLERDGELS
DSQ  ------TTCGAACAGTCCCTCACCGAGCTGCAAACCCTGGTGGAACGCCTGGAAAGCGGCGAGCTGTCGCTGGAAGAGTCGCTGGGCGCCTTCGAGCAGGGCATCCGCCTGACCCGCGAATGCCAGACGTCGCTGAGCCAGGCCGAACAGAAGGTACAG------ATCCTCCTCGAACGCGACGGCGAGCTCAGC
TRN  11011111101111111
NAM  EX7S_VIBCH/9-71
ASQ  MSFESTIEELEQLVEQLESGDLALDEALRKFERGISLARAGQLKLDDAEQRVR--ILLSNSDDAP
DSQ  ATGTCCTTCGAGTCAACCATCGAAGAGCTGGAACAGTTGGTCGAACAGCTAGAAAGTGGCGATCTGGCACTGGACGAAGCACTGCGCAAATTCGAGCGTGGCATCTCTTTAGCCAGAGCTGGCCAGCTCAAACTAGACGATGCTGAGCAGCGTGTGCGG------ATTTTGCTCAGTAACAGTGATGATGCCCCG
TRN  10010101100011000
NAM  EX7S_PASMU/11-73
ASQ  LDFENTLQQLEAIVTRLESGELPLESALEEFERGIKLAHLGQERLQQAEQRIQ--ILLQKSDSAK
DSQ  TTAGATTTTGAAAATACGCTACAACAGCTAGAAGCCATTGTCACACGTTTAGAAAGTGGTGAGCTTCCTTTGGAAAGCGCCTTAGAAGAATTTGAGCGTGGCATTAAGCTTGCCCATTTGGGACAAGAACGTTTACAACAAGCCGAACAACGCATTCAG------ATTTTATTACAAAAAAGTGACAGCGCGAAA
TRN  11011101111011010
NAM  EX7S_HAEIN/9-71
ASQ  QDFETTLVQLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAEQRIQ--ILLQKTEDAP
DSQ  CAAGATTTTGAAACAACGTTAGTGCAGTTAGAAAATATTGTTACACATTTAGAAAATGGCGATCTACCGTTAGAAGAAGCGTTAAAAGAATTTGAACAAGGTGTGCAATTAGCTAAGTTAGGGCAAGAACGTTTACAACAAGCAGAACAACGTATTCAG------ATCTTATTGCAAAAAACAGAAGACGCGCCA
TRN  11011101111011010
NAM  EX7S_ECOLI/8-70
ASQ  ASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRVQ--ILLSDNEDAS
DSQ  GCCAGCTTTGAAAAGGCGCTGAGCGAGCTGGAACAGATTGTAACCCGTCTGGAAAGTGGCGACCTGCCGCTGGAAGAGGCGCTGAACGAGTTCGAACGCGGCGTGCAGCTGGCACGTCAGGGGCAGGCCAAATTACAACAAGCCGAACAGCGCGTACAA------ATTCTGCTGTCTGACAATGAAGACGCCTCT
TRN  11011101101011010
//