EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02603 - Hpr_kinase_N)
FAM  PF02603
PID  Hpr_kinase_N
DES  HPr Serine kinase N terminus
IPR  IPR011126
ANO  4
ALN  129
AID  0.364929
APH  ((HPRK_TREPA/2-127:1.06684,HPRK_BACSU/1-127:0.48654):0.88657,HPRK_MYCGE/2-129:0.17959,HPRK_MYCPN/2-129:0.19036);
ATP  ((HPRK_TREPA/2-127,HPRK_BACSU/1-127),HPRK_MYCGE/2-129,HPRK_MYCPN/2-129);
ATL  2.80986
DNO  4
DLN  387
DID  0.455199
DPH  (HPRK_TREPA/2-127:0.63118,(HPRK_MYCGE/2-129:0.22772,HPRK_MYCPN/2-129:0.22497):0.44797,HPRK_BACSU/1-127:0.49380);
DTP  (HPRK_TREPA/2-127,(HPRK_MYCGE/2-129,HPRK_MYCPN/2-129),HPRK_BACSU/1-127);
DTL  2.02564
RID  0.364929
RPH  ((HPRK_TREPA/2-127:1.06684,HPRK_BACSU/1-127:0.48654):0.88657,HPRK_MYCGE/2-129:0.17959,HPRK_MYCPN/2-129:0.19036);
RTP  ((HPRK_TREPA/2-127,HPRK_BACSU/1-127),HPRK_MYCGE/2-129,HPRK_MYCPN/2-129);
RTL  2.80986
LNK  HPRK_BACSU/1-127:O34483:AF017113
LNK  HPRK_MYCGE/2-129:P47331:U39689
LNK  HPRK_MYCPN/2-129:P75548:AE000058
LNK  HPRK_TREPA/2-127:O83600:AE001234
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  HPRK_TREPA/2-127
ASQ  LKLDLKE-RDSLD--LRCIAGHHGLANPITISDLNRPGLVLSGFFDFVAYRRIQLFGRGEHAYLLALLEQGRYGAIEKMFTFDLPCCIFSHGITPPEKFLHLAEPSSCPILVTRLTSSELSLRLMRVLS
DSQ  CTCAAGCTCGATCTGAAAGAG---CGCGATTCGCTTGAT------CTGCGTTGTATCGCAGGTCACCATGGACTGGCAAATCCCATCACTATCTCGGATCTGAACCGACCAGGTCTTGTCCTGTCAGGCTTTTTTGACTTCGTTGCCTACCGGCGGATCCAGCTTTTTGGCCGCGGAGAACATGCGTATCTGCTCGCCCTTTTAGAGCAGGGACGATACGGTGCTATCGAAAAGATGTTCACCTTTGACTTGCCTTGTTGTATCTTTTCCCATGGAATTACCCCGCCGGAGAAGTTTTTGCATCTTGCTGAGCCTTCTTCTTGCCCTATCTTGGTCACTCGTCTTACGTCGAGCGAGCTTTCTTTACGTCTCATGCGTGTTCTCTCC
TRN  11011101101011000
NAM  HPRK_MYCPN/2-129
ASQ  KKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFS-SQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYIN
DSQ  AAAAAGTTATTAGTCAAGGAGTTAATCGAACAATTTCAGGATTGTGTTAACCTCATTGATGGGCACACTAACACCAGTAATGTAATTAGAGTACCCGGATTAAAGCGGGTGGTGTTTGAAATGCTGGGGTTGTTTTCC---AGCCAAATTGGCTCGGTAGCCATTTTGGGCAAACGCGAGTTTGGCTTTTTGAGTCAAAAAACGCTGGTTGAACAACAGCAAATTCTCCACAACTTACTCAAACTCAACCCACCAGCGATTATTTTGACCAAGTCCTTTACTGACCCCACGGTACTTTTACAGGTTAACCAGACTTATCAGGTACCGATCCTAAAGACCGATTTCTTTTCCACGGAACTTTCCTTTACGGTCGAAACCTACATTAAC
TRN  10010101100011010
NAM  HPRK_MYCGE/2-129
ASQ  KHLTVKALVLQFNDCIQLIDGKNNIDNVITIPGLKRSVFELLGLFC-KPIGSVAILGKREFIFLNQKPVEQQKKIIANLLKLKPPAVILTKSFLDCGVLLAVNQTYQVPILKTNLFSTELSFTVETYIN
DSQ  AAACATTTAACTGTCAAAGCATTAGTTTTGCAATTTAATGATTGTATCCAACTCATTGATGGTAAAAACAACATAGATAATGTGATTACTATCCCTGGGTTAAAAAGGAGTGTTTTTGAACTATTAGGACTATTTTGT---AAGCCAATTGGTTCAGTTGCTATTTTAGGTAAACGTGAATTTATTTTTTTAAATCAAAAGCCAGTTGAGCAACAGAAAAAGATTATTGCAAACCTCTTGAAACTCAAACCACCTGCAGTTATTCTAACCAAGTCATTTCTTGATTGTGGTGTTTTGTTAGCTGTTAATCAAACTTATCAAGTTCCTATTTTAAAAACTAACTTGTTTTCAACTGAACTCTCTTTTACTGTTGAAACCTATATTAAC
TRN  10010101110011000
NAM  HPRK_BACSU/1-127
ASQ  AKVRTKDVMEQFN--LELISGEEGINRPITMSDLSRPGIEIAGYFTYYPRERVQLLGKTELSFFEQLPEEEKKQRMDSLCTDVTPAIILSRDMPIPQELIDASEKNGVPVLRSPLKTTRLSSRLTNFLE
DSQ  GCAAAGGTTCGCACAAAAGACGTAATGGAACAGTTCAAT------TTGGAATTAATCAGCGGAGAAGAAGGAATTAACCGCCCGATTACAATGAGTGACCTATCAAGACCAGGTATTGAAATTGCCGGATATTTTACATATTACCCGAGGGAGCGCGTGCAGCTTCTCGGAAAAACAGAGCTTTCTTTCTTTGAACAGCTTCCTGAAGAGGAGAAAAAGCAGCGAATGGATTCTCTGTGCACTGATGTAACACCAGCTATTATTCTTTCTAGAGATATGCCCATCCCGCAGGAGCTGATTGACGCCTCCGAGAAAAATGGGGTGCCTGTCCTCAGATCGCCGCTGAAAACGACAAGACTGTCAAGCCGTTTAACCAACTTCCTTGAG
TRN  10010101100011000
//