EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02434 - Fringe)
FAM  PF02434
PID  Fringe
DES  Fringe-like
IPR  IPR003378
ANO  7
ALN  253
AID  0.619566
APH  ((((RFNG_CHICK/99-351:0.07994,RFNG_MOUSE/54-306:0.21590):0.05413,(RFNG_XENLA/89-340:0.15987,RFNG_NOTVI/124-375:0.11349):0.04407):0.12756,FNG_DROME/143-394:0.67631):0.10348,MFNG_HUMAN/49-300:0.34873,LFNG_MOUSE/107-357:0.18399);
ATP  ((((RFNG_CHICK/99-351,RFNG_MOUSE/54-306),(RFNG_XENLA/89-340,RFNG_NOTVI/124-375)),FNG_DROME/143-394),MFNG_HUMAN/49-300,LFNG_MOUSE/107-357);
ATL  2.10459
DNO  7
DLN  759
DID  0.623869
DPH  ((RFNG_XENLA/89-340:0.20698,RFNG_NOTVI/124-375:0.13533):0.09307,RFNG_CHICK/99-351:0.10951,(RFNG_MOUSE/54-306:0.18772,(FNG_DROME/143-394:0.51408,(MFNG_HUMAN/49-300:0.25399,LFNG_MOUSE/107-357:0.20524):0.07094):0.09035):0.08918);
DTP  ((RFNG_XENLA/89-340,RFNG_NOTVI/124-375),RFNG_CHICK/99-351,(RFNG_MOUSE/54-306,(FNG_DROME/143-394,(MFNG_HUMAN/49-300,LFNG_MOUSE/107-357))));
DTL  1.95639
RID  0.619566
RPH  ((((RFNG_CHICK/99-351:0.07994,RFNG_MOUSE/54-306:0.21590):0.05413,(RFNG_XENLA/89-340:0.15987,RFNG_NOTVI/124-375:0.11349):0.04407):0.12756,FNG_DROME/143-394:0.67631):0.10348,MFNG_HUMAN/49-300:0.34873,LFNG_MOUSE/107-357:0.18399);
RTP  ((((RFNG_CHICK/99-351,RFNG_MOUSE/54-306),(RFNG_XENLA/89-340,RFNG_NOTVI/124-375)),FNG_DROME/143-394),MFNG_HUMAN/49-300,LFNG_MOUSE/107-357);
RTL  2.10459
LNK  FNG_DROME/143-394:Q24342:L35770
LNK  LFNG_MOUSE/107-357:O09010:U94351
LNK  MFNG_HUMAN/49-300:O00587:Z93096
LNK  RFNG_CHICK/99-351:O12972:U82088
LNK  RFNG_MOUSE/54-306:O09009:U94350
LNK  RFNG_NOTVI/124-375:Q9YHB3:AF115388
LNK  RFNG_XENLA/89-340:P79949:U77641
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RFNG_NOTVI/124-375
ASQ  DALEFEDLFIAVKTTRKYHKTRLDLLLQTWISRAKQQTFIFTDGEDQDLRQRAGIQVINTNCSAMHTRQALCCKMAVEYDKFIESERKWFCHVDDDNYVNLFSLRHLLASFSHSQDVYLGRPSLDHPIEAIERVKSDGS-ASVRFWFATGGAGFCISRGLALKMSPWASMGNFITTAELVRLPDDCTIGYIIEGLLGVKMHHTPLFHSHLENLQRLPLQSVLKQVTLSYGGPDNKRNVVSVGGIFSLENDPTR
DSQ  GATGCTCTAGAGTTTGAGGACCTCTTTATTGCAGTGAAAACTACAAGGAAGTACCACAAAACCCGCCTGGACCTACTTCTGCAGACATGGATATCAAGAGCCAAACAACAGACATTCATATTTACTGATGGTGAAGACCAAGATCTGCGTCAAAGGGCAGGAATTCAAGTGATAAACACCAACTGCTCGGCCATGCACACACGCCAAGCTCTCTGCTGCAAGATGGCTGTGGAATATGACAAGTTCATTGAATCGGAACGAAAATGGTTCTGTCATGTGGATGATGACAATTACGTGAACTTGTTCTCCCTGCGGCATCTGTTGGCATCTTTTTCCCACAGCCAGGACGTATATCTTGGACGTCCCAGTCTAGACCATCCCATTGAAGCTATTGAGAGAGTGAAGAGTGATGGATCC---GCATCTGTGAGGTTCTGGTTTGCTACAGGAGGTGCCGGCTTCTGTATAAGCAGAGGGCTTGCTCTGAAAATGAGTCCCTGGGCCAGTATGGGTAATTTCATCACCACTGCAGAGCTGGTTCGCCTCCCAGATGACTGCACAATCGGTTACATCATTGAGGGGCTGTTAGGCGTGAAGATGCATCACACCCCCTTATTCCATTCTCATCTGGAGAACCTGCAGAGACTTCCCCTGCAGTCTGTCCTCAAACAGGTAACTCTGAGTTATGGGGGTCCTGACAACAAACGCAACGTTGTAAGCGTTGGAGGTATTTTCAGCCTGGAAAATGATCCAACTAGG
TRN  10010101100011000
NAM  RFNG_CHICK/99-351
ASQ  ESLELKDIFIAVKTTRKYHKTRLELLFQTWISRARGQTFIFTDWEDRELRLKAGDHMINTNCSAVHTRQALCCKMSVEYDKFLESGQKWFCHVDDDNYVNPRTLLRLLSAFSPSQDVYVGRPSLDHPIEAADHVQSDGSKTSVKFWFATGGAGFCISRGLALKMSPWASLGNFISTAERVRLPDDCTIGYIIEGLLEVKLLHSPLFHSHLENLQRLQGESVLQQVTLSYGDPENKHNVVSVGGVFGLQQDPTR
DSQ  GAGAGCCTGGAGCTAAAAGACATCTTTATTGCGGTGAAAACGACGAGGAAGTATCACAAGACGCGGCTGGAGCTGCTGTTCCAAACCTGGATCTCCCGGGCGAGAGGACAGACATTCATATTCACAGACTGGGAGGATCGAGAGCTGCGCCTGAAAGCAGGGGATCATATGATCAACACTAACTGTTCTGCTGTCCACACCCGGCAAGCTCTGTGCTGCAAGATGTCTGTGGAATATGATAAATTCCTAGAATCTGGACAAAAGTGGTTTTGCCATGTGGACGATGACAACTATGTGAATCCACGGACTCTCTTGCGTCTCTTATCTGCCTTCTCACCCAGCCAGGATGTCTATGTGGGACGACCGAGTCTGGACCATCCCATTGAAGCAGCTGACCATGTCCAAAGCGATGGATCAAAGACAAGCGTGAAATTCTGGTTTGCCACAGGTGGAGCAGGGTTCTGTATCAGCAGAGGTCTTGCTCTGAAGATGAGTCCCTGGGCCAGCCTGGGTAATTTCATCAGTACTGCAGAAAGAGTGCGTCTTCCTGATGACTGCACCATTGGCTACATCATTGAAGGGCTGCTGGAAGTAAAGCTGCTGCACAGCCCATTGTTCCATTCCCATCTGGAAAATCTGCAGAGACTACAAGGAGAGTCTGTGCTGCAACAGGTAACCCTAAGTTATGGGGACCCTGAGAACAAACACAATGTTGTGAGTGTGGGAGGAGTGTTTGGACTTCAGCAAGACCCAACCAGA
TRN  10010101100011000
NAM  RFNG_XENLA/89-340
ASQ  EPLQIKDLFIAVKTTKKYHGNRLNLLMQTWISRAKEQTFIFTDWEDQELRQKAGDQMVNTNCSAVHTRQALCCKMAVEYDKFVLSDKKWFCHLDDDNYLNLHALLDLLSTFSHSTDVYVGRPSLDHPVETVDRMKGDGS-GSLKFWFATGGAGFCISRGLALKMSPWASMGNFISTAEKVRLPDDCTIGYIIEGMLDVKMQHSNLFHSHLEHLQRLPTESLLKQVTLSYGGPDNKWNVVRVNGAFSLAEDPTR
DSQ  GAACCATTACAGATAAAAGATTTGTTTATTGCAGTAAAGACCACAAAGAAATATCACGGGAACCGTCTGAATCTTCTCATGCAAACCTGGATCTCCAGAGCAAAAGAACAGACCTTTATATTTACAGACTGGGAAGATCAAGAACTTCGACAAAAAGCAGGAGATCAAATGGTGAACACAAACTGTTCTGCAGTGCACACACGTCAGGCGCTCTGTTGCAAGATGGCTGTTGAATATGACAAATTTGTTTTGTCAGACAAAAAGTGGTTTTGCCATTTAGATGATGACAATTATCTGAATCTGCATGCACTTCTGGATCTGTTGTCGACATTCTCACACAGCACAGATGTTTATGTTGGGAGGCCCAGTTTAGATCATCCAGTTGAAACTGTGGATCGAATGAAAGGTGATGGCTCG---GGCTCTCTAAAGTTTTGGTTTGCGACTGGAGGTGCTGGATTCTGTATCAGTCGCGGTCTTGCACTTAAGATGAGCCCTTGGGCGAGCATGGGAAACTTCATCAGCACCGCTGAGAAGGTGCGTCTCCCTGATGACTGCACTATAGGCTACATAATCGAGGGGATGTTAGATGTGAAGATGCAGCACAGTAACCTGTTCCACTCACACTTAGAGCATCTGCAGAGACTTCCAACTGAATCTCTCTTAAAGCAGGTGACTCTAAGCTATGGCGGCCCGGATAACAAATGGAATGTTGTGAGAGTGAATGGAGCTTTCAGCCTGGCAGAGGATCCAACAAGG
TRN  10010101100011000
NAM  RFNG_MOUSE/54-306
ASQ  DRLQPDDVFIAVKTTRKNHGPRLRLLLRTWISRAPRQTFIFTDGDDPELQMLAGGRMINTNCSAVRTRQALCCKMSVEYDKFLESGRKWFCHVDDDNYVNPKSLLHLLSTFSSNQDIYLGRPSLDHPIEATERVQGGGTSNTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAERVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPSGAILQQVTLSYGGPENPHNVVNVAGSFNIQQDPTR
DSQ  GACCGCCTGCAACCCGACGACGTCTTCATTGCAGTCAAGACCACTCGGAAGAACCACGGCCCGCGCCTGCGGCTGCTGCTGCGTACCTGGATCTCACGAGCCCCACGGCAGACGTTCATTTTCACCGATGGAGACGACCCTGAGCTCCAGATGCTGGCAGGCGGCCGCATGATCAACACCAATTGCTCTGCTGTGCGCACCCGCCAAGCACTGTGCTGCAAAATGTCGGTGGAATATGATAAGTTCCTAGAATCTGGACGAAAATGGTTCTGCCACGTGGATGATGACAACTACGTGAACCCCAAAAGCCTGCTGCACCTGCTTTCCACCTTCTCTTCCAACCAGGACATCTACCTGGGGCGACCTAGCCTGGACCACCCCATCGAAGCCACAGAGAGGGTCCAAGGCGGTGGCACCTCAAACACAGTGAAATTCTGGTTTGCTACTGGTGGGGCTGGGTTCTGCCTGAGCAGGGGCCTTGCCCTCAAAATGAGCCCGTGGGCCAGCCTTGGCAGTTTCATGAGCACAGCAGAGCGCGTTCGGCTGCCTGATGACTGCACTGTGGGATACATCGTGGAAGGACTTCTGGGCGCCCGTCTGCTCCATAGCCCCCTGTTCCACTCGCACCTGGAAAACCTGCAGAGGCTGCCGTCTGGTGCTATTTTGCAGCAGGTTACCTTGAGCTATGGGGGTCCTGAGAACCCACATAATGTGGTGAATGTAGCTGGCAGTTTCAACATACAGCAGGACCCTACACGG
TRN  10010101100011001
NAM  LFNG_MOUSE/107-357
ASQ  EVLSPRDVFIAVKTTRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKLTG-NVVLTNCSSAHSRQALSCKMAVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERISEHKV-RPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSR
DSQ  GAAGTTCTGTCCCCTCGCGACGTCTTCATCGCCGTCAAGACCACCAGAAAGTTTCACCGCGCGCGGCTCGATCTGCTGTTCGAGACCTGGATCTCGCGCCACAAGGAGATGACGTTCATCTTCACTGATGGGGAGGACGAAGCTCTGGCCAAGCTCACAGGC---AATGTGGTGCTCACCAACTGCTCCTCGGCCCACAGCCGCCAAGCTCTGTCCTGCAAGATGGCTGTGGAGTATGACCGATTCATTGAGTCTGGGAAGAAGTGGTTCTGCCACGTGGATGATGACAACTACGTCAACCTCCGGGCGCTGCTGCGGCTCCTGGCCAGCTATCCCCACACCCAAGACGTGTACATCGGCAAGCCCAGCCTGGACAGGCCCATCCAGGCCACAGAACGGATCAGCGAGCACAAAGTG---AGACCTGTCCACTTTTGGTTTGCCACCGGAGGAGCTGGCTTCTGCATCAGCCGAGGGCTGGCCCTAAAGATGGGCCCATGGGCCAGTGGAGGACACTTCATGAGCACGGCAGAGCGCATCCGGCTCCCCGATGACTGCACCATTGGCTACATTGTAGAGGCTCTGCTGGGTGTACCCCTCATCCGGAGCGGCCTCTTCCACTCCCACCTAGAGAACCTGCAGCAGGTGCCCACCACCGAGCTTCATGAGCAGGTGACCCTGAGCTATGGCATGTTTGAGAACAAGCGGAACGCAGTGCACATCAAGGGACCATTCTCTGTGGAAGCTGACCCATCCAGG
TRN  10010101100011011
NAM  MFNG_HUMAN/49-300
ASQ  PKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRT-RLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
DSQ  CCTAAGCTACAGCTACACGATGTCTTCATTGCAGTGAAGACGACCCGGGCTTTCCACCGCTTGCGCCTGGAGCTGCTGCTTGACACGTGGGTTTCCAGGACCAGGGAACAGACATTTGTCTTCACCGACAGCCCAGACAAAGGCCTCCAGGAGAGACTGGGGTCCCACCTTGTGGTCACCAACTGCTCCGCGGAACACAGCCACCCAGCTCTGTCCTGCAAGATGGCTGCTGAGTTCGACACCTTCTTGGCCAGTGGGCTTAGGTGGTTCTGCCATGTGGACGATGACAACTATGTGAACCCAAGGGCGCTGCTGCAGCTTCTGAGAGCCTTCCCGCTGGCCCGCGACGTCTATGTGGGAAGGCCCAGCCTGAACCGGCCCATCCATGCCTCAGAGCCACAGCCCCACAACCGCACG---AGGCTGGTACAGTTCTGGTTTGCCACTGGGGGTGCTGGCTTCTGCATCAATCGCAAACTGGCTTTGAAGATGGCTCCGTGGGCCAGTGGCTCCCGTTTCATGGACACATCTGCTCTCATCCGGCTGCCTGATGACTGCACCATGGGCTATATCATTGAGTGCAAGCTGGGCGGCCGCCTGCAGCCCAGCCCCCTCTTTCACTCCCACCTGGAGACCCTGCAGCTGCTGAGGACTGCACAGCTCCCAGAACAGGTCACCCTCAGCTACGGTGTCTTTGAGGGGAAACTCAACGTCATTAAGCTACAGGGCCCCTTCTCCCCGGAGGAGGACCCCTCCAGA
TRN  10010101100011001
NAM  FNG_DROME/143-394
ASQ  PVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDG-FDMKTDPKR
DSQ  CCGGTCACCGAGTTGGATGACATTTTCATCAGCGTAAAGACGACGAAGAACTATCACGACACCCGGCTGGCGTTGATCATCAAGACCTGGTTCCAATTGGCCCGCGATCAGACCTGGTTCTTCACGGACACCGATGATCACTACTACCAGGAGAAGACAAAGGGCCATCTCATCAACACGAAATGCTCACAAGGCCATTTTCGCAAGGCGCTTTGCTGCAAAATGTCCGCTGAATTGGATGTCTTCCTGGAGAGTGGCAAAAAGTGGTTCTGTCACTTCGACGATGACAACTATGTCAATGTGCCGAGGCTGGTCAAACTGCTGGACGAGTATAGCCCCAGTGTGGATTGGTATCTGGGCAAGCCGAGCATCTCGTCGCCGCTGGAGATCCACTTGGACAGCAAGAACACGACAACAAACAAGAAGATAACCTTCTGGTTCGCCACTGGCGGCGCTGGCTTCTGCCTCAGTCGAGCCCTGACTTTAAAAATGCTACCCATAGCAGGTGGTGGCAAGTTTATCAGCATTGGCGACAAGATACGTTTTCCGGATGATGTCACAATGGGTTTTATTATTGAACACCTTCTGAAAGTTCCTCTAACCGTGGTGGACAACTTCCACTCGCATTTGGAGCCCATGGAGTTCATACGCCAGGATACGTTCCAGGACCAGGTGTCCTTCAGCTATGCCCACATGAAAAACCAGTGGAACGTGATCAAGGTGGACGGC---TTCGATATGAAAACCGATCCCAAGCGC
TRN  10010101100011000
//