EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02291 - TFIID-31kDa)
FAM  PF02291
PID  TFIID-31kDa
DES  Transcription initiation factor IID, 31kD subunit
IPR  IPR003162
ANO  5
ALN  134
AID  0.363433
APH  (((TAF9_SCHPO/3-133:0.27710,TAF9_YEAST/19-152:0.64257):0.47930,O45784_CAEEL/13-136:0.94081):0.10354,TAF9_DROME/8-136:0.37181,TAF9_HUMAN/2-130:0.26640);
ATP  (((TAF9_SCHPO/3-133,TAF9_YEAST/19-152),O45784_CAEEL/13-136),TAF9_DROME/8-136,TAF9_HUMAN/2-130);
ATL  3.08153
DNO  5
DLN  402
DID  0.449582
DPH  (((TAF9_YEAST/19-152:0.54697,TAF9_SCHPO/3-133:0.32993):0.26829,TAF9_HUMAN/2-130:0.23550):0.11930,TAF9_DROME/8-136:0.38758,O45784_CAEEL/13-136:0.71782);
DTP  (((TAF9_YEAST/19-152,TAF9_SCHPO/3-133),TAF9_HUMAN/2-130),TAF9_DROME/8-136,O45784_CAEEL/13-136);
DTL  2.60539
RID  0.363433
RPH  (((TAF9_SCHPO/3-133:0.27710,TAF9_YEAST/19-152:0.64257):0.47930,O45784_CAEEL/13-136:0.94081):0.10354,TAF9_DROME/8-136:0.37181,TAF9_HUMAN/2-130:0.26640);
RTP  (((TAF9_SCHPO/3-133,TAF9_YEAST/19-152),O45784_CAEEL/13-136),TAF9_DROME/8-136,TAF9_HUMAN/2-130);
RTL  3.08153
LNK  O45784_CAEEL/13-136:O45784:Z81120
LNK  TAF9_DROME/8-136:Q27272:U06458
LNK  TAF9_HUMAN/2-130:Q16594:U25112
LNK  TAF9_SCHPO/3-133:Q09869:Z66568
LNK  TAF9_YEAST/19-152:Q05027:Z49939
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O45784_CAEEL/13-136
ASQ  ASGTDGHS----KEALAVISMLHECGIQEFDPRVVSMLMDVQYAVTSKILQMSSGLSRHAEKAQIE-----AEDVQTAAD-MLGVLTTNAPDREKILQLANDKNQQPLPQIRHNYGLKLPNDRFCQLQQNFVYK
DSQ  GCAAGTGGTACCGATGGACACAGT------------AAAGAGGCGCTTGCTGTAATAAGCATGCTCCACGAGTGTGGAATTCAAGAGTTTGATCCACGCGTCGTTTCAATGCTTATGGATGTTCAATACGCAGTGACGTCAAAAATCCTCCAAATGTCAAGTGGACTGTCCAGGCATGCTGAAAAAGCGCAAATCGAG---------------GCAGAAGACGTTCAAACGGCGGCCGAC---ATGCTCGGCGTTCTGACCACAAACGCTCCGGACCGTGAGAAGATTCTGCAATTGGCGAATGACAAAAATCAGCAGCCCCTACCGCAAATTCGACACAATTATGGCCTGAAGCTGCCCAACGATCGATTCTGTCAATTACAGCAGAATTTTGTGTACAAA
TRN  10010101100011000
NAM  TAF9_DROME/8-136
ASQ  KAKISAQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTID-----LDDVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLR
DSQ  AAGGCCAAGATCAGTGCCCAAATCAAGCACGTGCCGAAGGACGCGCAGGTGATCATGTCCATCCTGAAGGAGCTGAATGTCCAGGAGTACGAGCCGCGCGTGGTCAACCAACTGCTGGAGTTCACCTTCCGCTATGTCACCTGCATTCTGGACGACGCCAAGGTATACGCCAACCATGCGCGCAAGAAGACCATCGAC---------------TTGGACGACGTGCGTCTGGCCACCGAGGTTACGCTGGACAAGAGCTTCACCGGGCCGTTGGAGCGCCACGTTCTAGCCAAGGTGGCCGACGTGCGCAACAGCATGCCCCTGCCACCCATTAAGCCGCACTGCGGTCTCCGACTGCCGCCCGACCGCTACTGTCTCACCGGCGTCAACTACAAACTGCGG
TRN  11011101101011011
NAM  TAF9_HUMAN/2-130
ASQ  ESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVD-----ADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLK
DSQ  GAGTCTGGCAAGACGGCTTCTCCCAAGAGCATGCCGAAAGATGCACAGATGATGGCACAAATCCTGAAGGATATGGGGATTACAGAATATGAGCCAAGAGTTATAAATCAGATGTTGGAGTTTGCCTTCCGATATGTGACCACAATTCTAGATGATGCAAAAATTTATTCAAGCCATGCTAAGAAAGCTACTGTTGAT---------------GCAGATGATGTGCGATTGGCAATCCAGTGCCGCGCTGATCAGTCTTTTACCTCTCCTCCCCCAAGAGATTTTTTATTAGATATTGCAAGGCAAAGAAATCAAACCCCTTTGCCATTGATCAAGCCATATTCAGGTCCTAGGTTGCCACCTGATAGATACTGCTTAACAGCTCCAAACTATAGGCTGAAA
TRN  10010101100011000
NAM  TAF9_YEAST/19-152
ASQ  EVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFAHRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAERNKKALPQVMGTWGVRLPPEKYCLTAKEWDLE
DSQ  GAAGTTGGTCCGGACTCAACACAAGAGGAAACGCCACGAGATGTCCGTCTTTTGCATCTGCTCCTCGCATCACAGTCGATTCATCAATATGAGGACCAAGTACCGCTACAATTGATGGATTTTGCACATAGGTACACACAAGGAGTCCTTAAGGACGCGTTGGTTTACAACGACTACGCTGGCAGTGGAAATTCTGCCGGCAGTGGATTAGGAGTAGAAGACATACGGCTTGCCATTGCAGCGAGAACACAATACCAATTTAAGCCTACGGCACCTAAGGAGCTCATGTTACAGTTAGCTGCGGAAAGAAACAAGAAGGCATTACCTCAAGTGATGGGTACGTGGGGTGTCAGGCTTCCCCCAGAAAAATATTGTCTCACAGCGAAGGAGTGGGACCTTGAG
TRN  10010101100011000
NAM  TAF9_SCHPO/3-133
ASQ  SPGISDESIKGPKDVRLIHLILSSLGVPSYSQTVPLQLLTFAHRYTQQLIQDSQVYAEHSRGQNAP---ISVEDVRLAVASQINHSFTGPPPKEFLLELAMERNRKPLPQIQPSYGFRLPPEKYCLTQPNWIVS
DSQ  TCTCCAGGAATAAGTGATGAATCTATAAAAGGACCTAAGGACGTTCGTCTGATTCATCTAATACTTAGCTCTCTGGGTGTTCCATCATACTCTCAAACAGTGCCTTTGCAGTTGTTAACATTTGCACATAGATATACACAGCAGTTAATCCAGGATTCACAGGTTTATGCGGAACATTCACGTGGGCAAAATGCTCCA---------ATTTCTGTAGAAGATGTACGTTTAGCTGTTGCTTCTCAAATCAATCACTCCTTCACTGGACCTCCACCAAAAGAATTTTTACTAGAGCTTGCTATGGAGAGAAATCGAAAACCTTTACCCCAAATTCAGCCGTCTTATGGGTTTCGTCTTCCACCGGAGAAGTACTGTTTAACTCAACCCAACTGGATTGTCAGT
TRN  10010101100011000
//