EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02224 - Cytidylate_kin)
FAM  PF02224
PID  Cytidylate_kin
DES  Cytidylate kinase
IPR  IPR011994
ANO  14
ALN  164
AID  0.374943
APH  (((((KCY_AQUAE/52-210:0.53363,KCY_RICPR/70-212:0.71226):0.27405,(KCY_ECOLI/61-218:0.19669,KCY1_HAEIN/56-213:0.28948):0.20491):0.12941,((KCY_BACSU/60-217:0.37714,KCY_SYNY3/62-222:0.41082):0.12978,(KCY_MYCLE/59-213:0.16190,KCY_MYCTU/62-220:0.18895):0.43450):0.13577):0.22330,((KCY_MYCGE/54-209:0.24974,KCY_MYCPN/54-209:0.23908):0.45272,(KCY1_BORBU/59-211:0.79022,O83303_TREPA/129-281:0.70863):0.41549):0.11187):0.54827,KCY_CHLPN/53-209:0.17405,KCY_CHLTR/53-209:0.29337);
ATP  (((((KCY_AQUAE/52-210,KCY_RICPR/70-212),(KCY_ECOLI/61-218,KCY1_HAEIN/56-213)),((KCY_BACSU/60-217,KCY_SYNY3/62-222),(KCY_MYCLE/59-213,KCY_MYCTU/62-220))),((KCY_MYCGE/54-209,KCY_MYCPN/54-209),(KCY1_BORBU/59-211,O83303_TREPA/129-281))),KCY_CHLPN/53-209,KCY_CHLTR/53-209);
ATL  8.38741
DNO  14
DLN  492
DID  0.449537
DPH  (((((KCY_ECOLI/61-218:0.24353,KCY1_HAEIN/56-213:0.28339):0.14318,(KCY_BACSU/60-217:0.44427,(KCY_SYNY3/62-222:0.32943,(KCY_MYCLE/59-213:0.15672,KCY_MYCTU/62-220:0.15760):0.34629):0.16253):0.07994):0.04922,O83303_TREPA/129-281:0.78350):0.10116,((KCY1_BORBU/59-211:0.56818,(KCY_AQUAE/52-210:0.42601,KCY_RICPR/70-212:0.45537):0.08239):0.09821,(KCY_MYCGE/54-209:0.23588,KCY_MYCPN/54-209:0.25610):0.31386):0.10811):0.37631,KCY_CHLPN/53-209:0.14417,KCY_CHLTR/53-209:0.29932);
DTP  (((((KCY_ECOLI/61-218,KCY1_HAEIN/56-213),(KCY_BACSU/60-217,(KCY_SYNY3/62-222,(KCY_MYCLE/59-213,KCY_MYCTU/62-220)))),O83303_TREPA/129-281),((KCY1_BORBU/59-211,(KCY_AQUAE/52-210,KCY_RICPR/70-212)),(KCY_MYCGE/54-209,KCY_MYCPN/54-209))),KCY_CHLPN/53-209,KCY_CHLTR/53-209);
DTL  6.64411
RID  0.374943
RPH  (((((KCY_AQUAE/52-210:0.53363,KCY_RICPR/70-212:0.71226):0.27405,(KCY_ECOLI/61-218:0.19669,KCY1_HAEIN/56-213:0.28948):0.20491):0.12941,((KCY_BACSU/60-217:0.37714,KCY_SYNY3/62-222:0.41082):0.12978,(KCY_MYCLE/59-213:0.16190,KCY_MYCTU/62-220:0.18895):0.43450):0.13577):0.22330,((KCY_MYCGE/54-209:0.24974,KCY_MYCPN/54-209:0.23908):0.45272,(KCY1_BORBU/59-211:0.79022,O83303_TREPA/129-281:0.70863):0.41549):0.11187):0.54827,KCY_CHLPN/53-209:0.17405,KCY_CHLTR/53-209:0.29337);
RTP  (((((KCY_AQUAE/52-210,KCY_RICPR/70-212),(KCY_ECOLI/61-218,KCY1_HAEIN/56-213)),((KCY_BACSU/60-217,KCY_SYNY3/62-222),(KCY_MYCLE/59-213,KCY_MYCTU/62-220))),((KCY_MYCGE/54-209,KCY_MYCPN/54-209),(KCY1_BORBU/59-211,O83303_TREPA/129-281))),KCY_CHLPN/53-209,KCY_CHLTR/53-209);
RTL  8.38741
LNK  KCY1_BORBU/59-211:O51154:AE001124
LNK  KCY1_HAEIN/56-213:P43892:U32801
LNK  KCY_AQUAE/52-210:O67907:AE000775
LNK  KCY_BACSU/60-217:P38493:U11687
LNK  KCY_CHLPN/53-209:Q9Z7Y5:AE001641
LNK  KCY_CHLTR/53-209:O84458:AE001319
LNK  KCY_ECOLI/61-218:P23863:U00096
LNK  KCY_MYCGE/54-209:P47572:U39714
LNK  KCY_MYCLE/59-213:Q49885:U00021
LNK  KCY_MYCPN/54-209:P75308:AE000034
LNK  KCY_MYCTU/62-220:P63803:BX842577
LNK  KCY_RICPR/70-212:Q9ZD27:AJ235272
LNK  KCY_SYNY3/62-222:Q55074:U44896
LNK  O83303_TREPA/129-281:O83303:AE001209
AMK  xxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  KCY_MYCTU/62-220
ASQ  ETIASTVQMSLGYDPDGDS-.CYLAGEDVSVE-IRGDAVTRAVSAVSSVPAVRTRLVELQRTMAEG.PGSIVVEGRDIGTVVFPDAPVKIFLTASAETRARRRNAQNVAAG-LADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVIVDTSDMTEAEVVAHLLE
DSQ  GAGACGATTGCGTCGACGGTGCAGATGTCGTTAGGCTACGATCCCGACGGAGACAGC---...TGTTACCTTGCCGGAGAAGACGTTTCGGTTGAG---ATACGCGGTGACGCGGTCACCCGTGCGGTCTCCGCGGTGTCGTCGGTGCCGGCCGTACGCACCCGGCTGGTCGAGCTGCAGCGAACAATGGCTGAGGGC...CCGGGCAGCATCGTCGTGGAGGGCCGCGACATCGGAACCGTGGTGTTTCCGGATGCGCCGGTGAAAATCTTCTTGACCGCCTCGGCCGAAACGCGGGCCCGGCGGCGCAACGCCCAAAACGTCGCGGCGGGT---TTGGCCGACGACTATGACGGGGTATTGGCCGATGTGCGCCGGCGCGACCACCTCGATTCCACCCGGGCGGTGTCACCGCTGCAAGCCGCCGGTGATGCCGTCATCGTGGACACCAGCGATATGACCGAGGCCGAGGTGGTCGCCCATCTGTTGGAG
TRN  10010101100011000
NAM  KCY_MYCLE/59-213
ASQ  GESVWKVQMLS----DHDR-.YFLGGEDVSSE-IRTEEVTQAVSAVSAIPAVRVRLVDLQRQMAEG.RGSVVVEGRDIGTVVLPDAPVKIFLTASPETRARRRNDQNVASG-SADDYDRVLAEVRRRDHLDSTRAVSPLYVAQDAMIVDTSKMAEAEVIAHLMD
DSQ  GGGGAGAGTGTTTGGAAAGTGCAGATGCTCTCC------------GATCATGATCGT---...TATTTCCTTGGTGGAGAGGATGTTTCATCTGAG---ATACGGACTGAGGAGGTCACCCAGGCGGTGTCGGCGGTGTCGGCGATTCCTGCCGTGCGCGTCCGGCTTGTTGATCTGCAGCGACAGATGGCCGAAGGG...CGAGGCAGTGTCGTTGTAGAGGGCCGCGATATTGGGACCGTTGTATTACCCGACGCTCCGGTGAAGATCTTTCTGACGGCATCGCCCGAAACCCGCGCGCGACGTCGCAACGACCAGAATGTCGCGTCAGGT---TCGGCCGACGATTATGACCGCGTGTTGGCCGAAGTGCGCCGCCGCGACCATCTCGACTCCACCCGGGCGGTGTCGCCGTTGTATGTGGCTCAAGACGCCATGATTGTTGACACCAGCAAGATGGCTGAAGCCGAGGTGATCGCCCACCTAATGGAC
TRN  10010101100011000
NAM  KCY_SYNY3/62-222
ASQ  AELTSGAEIELMPRPAPQLTgVKVNGQDVSDA-IRTPAVTQLVSTIAAQGAVRAKLLKLQRKYGD-.QGGIVAEGRDIGTQVFPNAELKIFLTASVQERARRRLKDFEAQGNQAVDLAQLEADIAHRDHLDSTRAIAPLQKAVDAVEIITDNLTIAEVVETIIE
DSQ  GCGGAACTTACCAGTGGTGCGGAGATTGAACTAATGCCCCGTCCTGCCCCCCAATTGACCggaGTTAAAGTTAATGGGCAAGATGTCAGTGATGCC---ATTCGCACCCCGGCGGTGACCCAATTGGTTTCCACCATTGCTGCCCAGGGAGCCGTTCGAGCCAAGTTACTAAAACTACAAAGGAAGTATGGCGAC---...CAAGGAGGAATTGTGGCGGAAGGTCGGGACATTGGCACCCAGGTTTTTCCCAACGCGGAATTGAAAATTTTCCTCACCGCTTCAGTTCAGGAACGAGCCCGCCGTCGCCTCAAGGATTTTGAAGCTCAGGGTAATCAAGCAGTGGATTTAGCCCAATTGGAAGCGGACATTGCCCACCGGGATCATCTTGATAGCACTAGGGCGATCGCTCCTTTGCAGAAGGCAGTGGATGCAGTGGAAATTATTACCGATAACCTCACCATTGCCGAGGTGGTGGAGACTATTATTGAA
TRN  10010101110011000
NAM  KCY_BACSU/60-217
ASQ  AELLKRTDIELITTKDGQK-.VFVNGTDVTEA-IRTDEISNQVSIAAKHRSVREEMVKRQQQLGE-.KGGVVMDGRDIGTHVLPNAEVKIFLLASVEERAKRRYEENVKKG-FDVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILE
DSQ  GCTGAGCTGCTAAAGCGGACAGACATTGAGCTGATTACAACAAAAGATGGACAAAAA---...GTGTTTGTAAACGGCACCGATGTAACTGAGGCG---ATCAGAACAGATGAAATCAGCAACCAAGTTTCAATTGCGGCCAAGCACAGAAGTGTCAGAGAAGAAATGGTGAAACGCCAGCAGCAGCTTGGGGAA---...AAAGGCGGCGTCGTCATGGATGGTCGTGACATCGGGACGCATGTGCTGCCAAATGCAGAAGTAAAAATCTTTCTTTTGGCATCTGTGGAAGAGAGAGCGAAACGCCGTTATGAAGAAAATGTGAAAAAAGGC---TTTGATGTCAACTACGAAACATTAATTGAGGAAATTGCAAGAAGAGACAAGCTTGATTCAGAGCGCGAAGTATCTCCGCTGCGTAAAGCAGAAGACGCTCTTGAAATCGACACGACATCGCTTTCCATTCAAGAGGTAGCTGATAAAATCCTCGAG
TRN  10010101100011000
NAM  KCY1_HAEIN/56-213
ASQ  AELARHLDIQFIPQ-NGEVS.ILLAGMDVSRL-IRTQEVADAASKVAVFQKVRSALLQLQQDFAK-.NDGLIADGRDMGTVVFPNAQVKLFLDASAEERAKRRYKQLQNKG-INGNFAQILAEIKERDFRDRNREVAPLKPADDALLLDSTTLSIDEVIDQALA
DSQ  GCAGAATTAGCTCGTCATTTAGATATTCAATTTATTCCTCAA---AATGGCGAGGTAAGC...ATTTTGCTTGCAGGAATGGATGTGAGCCGTTTA---ATTCGCACGCAAGAAGTGGCAGATGCTGCGTCAAAAGTAGCAGTCTTTCAAAAAGTGCGGTCAGCTTTATTACAACTTCAGCAAGATTTTGCAAAA---...AATGATGGATTAATTGCGGATGGCAGAGATATGGGGACTGTGGTATTCCCAAATGCACAAGTAAAATTATTTTTAGATGCAAGTGCTGAAGAACGTGCAAAAAGACGCTATAAACAGTTGCAAAATAAAGGA---ATAAATGGTAACTTTGCACAGATTTTAGCCGAGATAAAAGAGCGTGATTTTCGTGATAGAAATCGTGAAGTTGCGCCGCTAAAACCAGCAGATGATGCTTTATTATTGGATAGTACAACCTTGAGTATCGATGAAGTTATTGATCAGGCGTTAGCT
TRN  10010101110011000
NAM  KCY_ECOLI/61-218
ASQ  VPLASHLDVRFVST-NGNLE.VILEGEDVSGE-IRTQEVANAASQVAAFPRVREALLRRQRAFRE-.LPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKG-FSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQ
DSQ  GTACCGCTGGCATCCCATCTGGATGTACGTTTTGTGTCGACC---AATGGCAATCTGGAA...GTGATCCTCGAAGGGGAAGATGTCAGCGGCGAA---ATTCGTACTCAGGAAGTGGCGAATGCAGCTTCACAAGTCGCGGCATTCCCACGCGTTCGTGAAGCATTATTGCGTCGCCAACGCGCGTTTCGCGAA---...TTACCAGGTCTGATTGCCGATGGCCGCGACATGGGAACGGTGGTATTCCCTGATGCACCAGTGAAAATTTTCCTTGACGCCTCCTCGGAAGAACGTGCGCATCGCCGCATGCTACAGTTGCAGGAGAAGGGC---TTTAGTGTTAACTTTGAGCGCCTTTTGGCCGAGATCAAAGAACGCGACGACCGCGATCGTAACCGAGCGGTAGCGCCACTGGTTCCGGCAGCCGATGCTTTAGTGTTGGATTCCACCACCTTAAGCATTGAGCAAGTGATTGAAAAAGCGCTACAA
TRN  11011101101011000
NAM  KCY_RICPR/70-212
ASQ  IALSKELKLDN---------.----NIDLENE-----DIGDIASQIAVISDVRNNLNENLINLVKT.TPRIIMEGRDIGTVVAPDADLKIFITASPYVRAIRRYNQLQAKG-KTCILDEIIQQIILRDKRDKERKAGPLLPALGAFIIDTSKLSAIEIVEEVTN
DSQ  ATTGCTTTATCTAAAGAATTAAAACTTGATAAT---------------------------...------------AATATTGATTTAGAGAATGAG---------------GATATAGGAGATATTGCATCACAAATTGCAGTAATAAGTGATGTGAGAAATAATCTAAATGAAAATTTGATTAATCTAGTTAAAACA...ACGCCGAGAATTATTATGGAGGGTAGAGATATAGGTACTGTTGTTGCACCTGATGCTGATTTAAAGATTTTTATCACTGCAAGTCCTTATGTAAGAGCTATAAGACGATATAATCAGTTGCAAGCAAAAGGG---AAAACATGTATACTTGATGAAATTATACAGCAAATAATTTTGCGAGATAAAAGAGATAAAGAGCGAAAAGCCGGCCCATTATTACCGGCTTTAGGTGCTTTCATTATTGATACTTCAAAACTTTCTGCTATAGAAATTGTAGAAGAAGTAACAAAT
TRN  10010101110011000
NAM  KCY_AQUAE/52-210
ASQ  IDKLFSLPVKVVPKIGKTE-.VYIEGKPVNEEDLRSEEVGKRASELGSIPEFRERINKLFKEIIN-.NKQMVVEGRDAGTHIIPEAPVKVFITASPEERAKRRYEQLKELG-YEVSFEEILQKILERDKRDMERPKYPFKPAEDAVIIDTTRKSVEEVVEEVLK
DSQ  ATAGATAAACTCTTTAGTCTTCCCGTTAAAGTTGTGCCTAAAATCGGAAAGACAGAA---...GTTTATATTGAGGGAAAGCCGGTTAACGAAGAAGACTTAAGGAGTGAAGAAGTAGGAAAAAGGGCATCCGAACTCGGTTCTATCCCCGAATTCAGGGAGAGAATTAATAAACTCTTCAAGGAGATAATAAAC---...AACAAACAGATGGTAGTTGAGGGAAGGGACGCAGGAACTCACATAATCCCAGAAGCACCTGTTAAGGTTTTCATAACAGCCTCTCCTGAGGAGAGGGCAAAGAGAAGGTACGAACAACTAAAAGAGCTGGGA---TACGAGGTTTCCTTTGAAGAAATACTCCAGAAAATACTGGAAAGGGATAAAAGAGACATGGAAAGACCAAAGTACCCCTTCAAGCCTGCAGAAGATGCCGTTATTATAGATACGACCAGAAAAAGCGTTGAAGAAGTGGTCGAAGAAGTCTTAAAG
TRN  10010101100011010
NAM  KCY_CHLTR/53-209
ASQ  EDFLASPPFSFSFSKDSPLQ.AFYGDRLLTSE-LSSQEVANFASLFSKEPLVRAYMQTLQKQYAT-.VGNCVFEGRDMGSKVFPHAEVKIFLTAKPEIRAERRLKDLPQGSLSK---EALMAELIARDQADQQRECDPLVIPQDATVIDSSDLTISQILEKILP
DSQ  GAAGATTTTCTTGCTTCACCTCCTTTTTCTTTCTCCTTTTCTAAAGATTCTCCTTTACAA...GCTTTCTATGGAGATCGCCTTCTCACTTCCGAG---TTAAGCTCTCAAGAAGTAGCGAATTTTGCATCGCTCTTCTCTAAGGAGCCTCTAGTTCGAGCCTACATGCAAACCTTACAAAAGCAATACGCGACA---...GTAGGGAATTGTGTATTTGAAGGCCGCGATATGGGCTCGAAAGTGTTCCCCCATGCTGAAGTAAAAATCTTCTTAACAGCTAAACCAGAGATTCGTGCAGAACGACGCCTAAAAGACCTCCCTCAAGGTTCCTTGTCTAAA---------GAGGCTTTAATGGCAGAACTCATTGCTCGTGACCAAGCAGATCAACAAAGAGAGTGCGATCCTCTTGTGATCCCTCAAGATGCCACAGTTATTGACTCTTCTGATTTGACAATAAGCCAAATTCTGGAGAAAATCCTACCT
TRN  10010101100011000
NAM  KCY_CHLPN/53-209
ASQ  TKFLEEPPFSFTFATGQPLE.SFFNGHLLTSE-LTTQEVANAASELSQLPEVRAFMQDLQRRYAQ-.LGNCVFEGRDMGSKVFPNADLKIFLTSSPEVRAQRRLKDLPEGTLSP---EQLQAELVKRDAADAQRAHDPLVIPENGIVIDSSDLTIRQVLEKILA
DSQ  ACTAAATTTTTAGAAGAGCCTCCTTTTTCTTTTACCTTTGCTACAGGCCAACCTTTAGAG...TCGTTTTTTAATGGTCATCTTCTTACCTCTGAA---TTAACAACTCAAGAAGTTGCGAACGCAGCATCGGAGCTCTCTCAACTTCCAGAAGTTCGTGCATTCATGCAAGATTTGCAACGACGCTATGCTCAG---...CTTGGCAACTGTGTATTTGAAGGAAGGGATATGGGATCCAAAGTCTTTCCCAACGCAGATTTAAAAATTTTTCTAACTTCAAGTCCTGAAGTTCGTGCGCAACGGCGTTTAAAAGACCTTCCTGAAGGGACTCTTTCTCCT---------GAGCAATTGCAAGCAGAGCTTGTCAAACGTGATGCTGCAGATGCACAACGCGCTCACGATCCCCTAGTCATCCCTGAAAATGGAATTGTAATTGACTCTTCGGATTTGACAATAAGACAAGTTCTGGAGAAAATTTTAGCT
TRN  10010101100011000
NAM  KCY_MYCPN/54-209
ASQ  LLKVIN-QINWRFEHEK---.VFYNNADISEV-ILNQEIAQLASNLATNPEVRKMAVLRQQALAK-.NTNIVMDGRDIGTVVLKDAQLKYFLDAKPEIRAQRRAQDLGIAYDSDKAFQELVAEIKHRDAVDTSRTADPLVQAPDAIYIDSSNLTFQQVVELMVQ
DSQ  TTGTTAAAGGTGATTAAC---CAAATTAACTGGCGCTTTGAACACGAAAAG---------...GTGTTTTATAACAACGCTGATATCTCAGAGGTT---ATCCTAAACCAGGAAATTGCCCAACTAGCGAGCAATTTAGCAACCAATCCCGAAGTGCGTAAGATGGCGGTATTGCGCCAACAAGCGTTAGCTAAA---...AACACCAACATTGTGATGGATGGACGCGACATTGGTACCGTTGTATTGAAGGACGCGCAGTTAAAGTACTTCTTGGATGCTAAACCGGAAATAAGAGCGCAACGACGCGCCCAAGATCTTGGCATAGCATATGACAGTGACAAGGCCTTTCAGGAACTAGTAGCGGAAATTAAGCACCGTGATGCGGTGGATACTTCCAGAACTGCTGATCCCTTAGTGCAAGCCCCCGATGCGATTTACATCGACAGTTCTAACCTTACTTTTCAGCAAGTAGTCGAGTTAATGGTGCAA
TRN  10010101110011000
NAM  KCY_MYCGE/54-209
ASQ  FLKIIN-QINWRFEKDA---.VYYNNADITTV-ITTQSVANIASKIAVDPNIRKIAVIKQQKLAE-.NKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQDMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLK
DSQ  TTTTTAAAAATCATTAAT---CAAATTAACTGACGCTTTGAGAAAGATGCT---------...GTGTATTATAACAATGCTGATATTACAACAGTT---ATTACAACCCAATCAGTTGCTAACATTGCTAGTAAAATAGCTGTTGATCCTAACATTAGAAAAATTGCAGTTATTAAACAACAGAAACTAGCAGAA---...AATAAAAACATAGTGATGGATGGTAGAGACATAGGAACAGTAGTTTTAAAAAATGCTCAATTGAAGTTTTTTTTAGATGCTAAAGTTGAAATTAGAGCGCAGCGAAGATTACAAGATATGGGAATTTCTCTATCAAATGAAAAAAAACTAAAGGAACTAATTCAAGAATTAAAGCAACGTGATCAAATTGATAGTTCTAGAACTGCAGACCCATTAAAAAAAGCCCAGGACGCTATTTATCTTGACACTTCTGAACTAAGTTTTGATGCAGTAGTAAAACAAACCCTCAAA
TRN  00010000000000000
NAM  O83303_TREPA/129-281
ASQ  YWVSFARTVALSYRAG----.VMYVGEENVESLLRSDEVESAVSYFAAMPAIRAIMTGKIRSAVC-.GARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRL-SK---QELEQRMRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAR
DSQ  TATTGGGTTTCGTTTGCGCGCACAGTTGCGCTTTCTTATCGTGCGGGT------------...GTGATGTACGTGGGCGAAGAGAACGTGGAGTCACTGCTGCGTTCGGATGAGGTGGAGTCGGCAGTCTCGTACTTCGCGGCAATGCCGGCTATTCGGGCAATTATGACGGGGAAGATCCGGTCGGCCGTTTGT---...GGTGCGCGGGTAGTTTGTGAAGGGCGTGATCTAACGACGGTTGTGTTTGTGGATGCGGACTTGAAGTGCTACCTTGACGCTTCTATTGAGGCGCGTGTGGCGCGTCGTTGGGCGCAGGGAACGAGCCGGTTA---TCGAAG---------CAGGAACTCGAGCAGCGCATGCGCGCGCGTGACGCACACGACAGGGCGCGCACCGTGGGGGGGCTCAGGTGTGCGCCTGATGCGCTGTACGTGGATACTTCTTGCTTGACCATTGAGGAGGTTTGTGAAAGAATGCGCGCG
TRN  10010101100011000
NAM  KCY1_BORBU/59-211
ASQ  LNLILENDISFNNFA-----.FLLNGENVENQ-ILNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFsDDNYIIEGRDITTVVFPESEFKIYLDASVKVRALRRYKQRNGNE----TLEELERTLKRRDDVDKKKQYGKLKLSKGVFYLDTSYKGLDDVCNIIIE
DSQ  TTAAATTTGATTCTTGAGAATGATATAAGTTTTAATAATTTTGCC---------------...TTTTTGCTTAATGGAGAGAATGTTGAAAATCAA---ATTTTAAACGATAAGATTGATTTTCAAGTTTCTTTTTATTCTTCTTATGTTGGAATAAGAAACATTGTGAATAAAAAATTAAGAGAGGTTGTTAAATTTagcGATGATAATTATATAATAGAAGGTAGAGATATTACTACTGTAGTTTTTCCAGAATCTGAATTTAAAATATATCTCGATGCTTCTGTTAAAGTTCGAGCTTTGAGGCGATATAAGCAAAGAAATGGGAATGAG------------ACCTTAGAAGAATTAGAGCGTACTCTTAAAAGAAGAGATGATGTTGACAAGAAAAAACAATATGGTAAGTTAAAATTATCAAAAGGGGTTTTTTACCTTGATACAAGCTACAAAGGATTAGACGATGTGTGTAATATTATAATAGAA
TRN  10010101110011000
//