EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02217 - T_Ag_DNA_bind)
FAM  PF02217
PID  T_Ag_DNA_bind
DES  Origin of replication binding protein
IPR  IPR003133
ANO  7
ALN  131
AID  0.379596
APH  ((TALA_SV40/137-258:0.31641,((TALA_POVLY/201-325:0.42427,(TALA_POVMC/286-405:0.23878,TALA_POVHA/262-383:0.41088):0.13850):0.17404,TALA_POVBO/97-216:0.58384):0.28589):0.15084,Q9IBL1_BFDV/112-225:1.52929,TALA_POVMK/152-274:0.48478);
ATP  ((TALA_SV40/137-258,((TALA_POVLY/201-325,(TALA_POVMC/286-405,TALA_POVHA/262-383)),TALA_POVBO/97-216)),Q9IBL1_BFDV/112-225,TALA_POVMK/152-274);
ATL  4.73752
DNO  4
DLN  393
DID  0.435364
DPH  (TALA_POVMK/152-274:0.33460,(TALA_POVHA/262-383:0.38998,TALA_POVLY/201-325:0.34150):0.23770,Q9IBL1_BFDV/112-225:1.03708);
DTP  (TALA_POVMK/152-274,(TALA_POVHA/262-383,TALA_POVLY/201-325),Q9IBL1_BFDV/112-225);
DTL  2.34085
RID  0.325302
RPH  (TALA_POVMK/152-274:0.39043,(TALA_POVHA/262-383:0.45516,TALA_POVLY/201-325:0.39915):0.44536,Q9IBL1_BFDV/112-225:1.56719);
RTP  (TALA_POVMK/152-274,(TALA_POVHA/262-383,TALA_POVLY/201-325),Q9IBL1_BFDV/112-225);
RTL  3.25729
LNK  Q9IBL1_BFDV/112-225:Q9IBL1:AF241169
LNK  TALA_POVBO/97-216:P24851:
LNK  TALA_POVHA/262-383:P03075:M26281
LNK  TALA_POVLY/201-325:P04008:M30540
LNK  TALA_POVMC/286-405:P12905:
LNK  TALA_POVMK/152-274:P24597:M55904
LNK  TALA_SV40/137-258:P03070:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TALA_POVMK/152-274
ASQ  DMPADLMEYLSCAILSNKTLPCFLIYTTLEKVELLYNKLSEE----VLSPRFN-QVDHKYGRKYVPIFIITGTKHRVSAVFNYCATYCSVSFIVVKGVIKEYPLYCHLCV-EPYSVLQESIE-ELNSEFF-
DSQ  GATATGCCTGCTGACTTAATGGAATACCTAAGCTGTGCTATCCTTTCAAATAAGACATTACCTTGCTTTCTGATTTACACCACCTTAGAAAAAGTGGAGTTGCTTTATAATAAATTATCTGAGGAA------------GTATTAAGTCCTAGATTTAAT---CAGGTAGACCATAAATATGGAAGGAAATACGTTCCAATTTTTATCATAACTGGAACTAAACACAGAGTTAGCGCAGTGTTTAATTATTGTGCAACATATTGTAGTGTTTCTTTTATAGTTGTTAAAGGTGTAATTAAGGAATATCCATTATATTGTCATTTATGTGTA---GAACCCTATTCTGTCCTGCAAGAGAGTATTGAA---GAGTTAAATTCAGAATTCTTT---
TRN  10010101100011000
NAM  TALA_SV40/137-258
ASQ  DFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIME-----KYSVTFI-SRHNSYN-HNI-LFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTR-DPFSVIEESLPGGLKEHDFN
NAM  TALA_POVLY/201-325
ASQ  DFPVCLYSFLSHAIYSNKTMNSFLIYTTLEKARQLYKTVEKSKIVVDFKASFS-YQDEEGE-GCL-LFLITLGKHRVSAVKHFCVSQCTFSFIHCKAVVKPLELYKTLSK-PPFKLLEENKPG-VSMFEF-
DSQ  GATTTTCCTGTATGTTTATATTCCTTTTTAAGTCATGCAATTTATAGTAATAAGACTATGAATAGTTTTTTAATATATACTACTTTGGAGAAAGCCAGGCAACTGTATAAAACTGTGGAAAAATCTAAAATTGTAGTTGATTTTAAGGCTAGTTTTTCT---TATCAGGATGAGGAAGGGGAG---GGGTGTTTG---CTGTTTTTAATTACTTTAGGAAAACATAGAGTGTCTGCTGTTAAGCATTTTTGTGTATCCCAATGTACTTTTAGTTTTATTCATTGTAAAGCTGTTGTTAAACCTCTAGAGTTATATAAGACCTTAAGTAAA---CCACCTTTTAAGTTGTTGGAAGAGAACAAACCGGGT---GTATCCATGTTTGAGTTC---
TRN  10010101100011010
NAM  TALA_POVMC/286-405
ASQ  DFPSSLTGYLSHAIYSNKTFPAFLVYSTKEKCKQLYDTIGK------FRPEFK-CLVHYEE-GGM-LFFLTMTKHRVSAVKNYCSKLCSVSFLMCKAVTKPMECYQVVTA-APFQLITENKP-GLHQFEFT
NAM  TALA_POVHA/262-383
ASQ  DFPTILRGFLSHAIFSNKTQNAFIIYSTKEKCEVLYEQIDK------YNPDYKGIFIMKQT-EAF-VMFMTPGKHRVAAVKSYCCKFCTVSFLLCKAVTKPLELYNCVAKCDDFQILKENKPG-LYHFEFC
DSQ  GATTTTCCTACTATCCTTAGGGGGTTTCTTTCTCACGCTATTTTTTCTAATAAAACGCAAAATGCATTTATAATCTACAGTACTAAGGAAAAATGTGAAGTACTTTATGAACAAATAGACAAA------------------TATAATCCAGACTATAAAGGTATCTTCATTATGAAACAAACA---GAAGCATTT---GTAATGTTTATGACTCCTGGAAAACATAGAGTAGCTGCAGTTAAAAGTTACTGTTGTAAATTTTGTACCGTTAGCTTCCTGCTATGCAAAGCTGTTACAAAACCGTTAGAGTTGTATAACTGTGTGGCTAAATGTGATGACTTTCAAATTTTAAAAGAAAATAAGCCTGGT---CTATATCATTTTGAATTCTGT
TRN  10010101100011010
NAM  TALA_POVBO/97-216
ASQ  DFPEVLKEYVSNALFTNRTYNCFIIFTTAEKGKELYPCIQAA-----YKCTFI-ALYMYNG-DSV-LYIITVGKHRVNAMENLCSKKCTVSFLQAKGVLKPQEAYNVCCT---FELISQNIQGGLPSSFFN
NAM  Q9IBL1_BFDV/112-225
ASQ  ELPPEVEAYLLTPRSVQSCPDCHLLITSITKMPQLKAHLYE-----HFGIKGH-MLAHWTG-IAL-LVLQLEKPTRISTVHNFCKKYCTISICSVRGIKKNCVH--ALIK-TLLDV-----PG-LDLEECS
DSQ  GAGCTACCCCCAGAGGTAGAAGCTTATTTACTAACCCCACGCTCCGTGCAGAGCTGCCCTGATTGCCACTTGCTTATTACCTCAATTACCAAAATGCCGCAACTTAAGGCCCACCTTTATGAG---------------CACTTCGGGATAAAGGGACAT---ATGCTTGCGCATTGGACTGGG---ATCGCGTTG---CTCGTGCTTCAGCTAGAAAAACCGACGCGTATATCGACGGTGCATAACTTTTGCAAAAAATACTGTACCATTTCGATATGTTCTGTACGTGGTATTAAAAAGAATTGTGTTCAT------GCTCTTATTAAA---ACCCTGCTAGATGTG---------------CCAGGC---CTGGACCTGGAGGAATGCAGT
TRN  10010101100011000
//