EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02184 - HAT)
FAM  PF02184
PID  HAT
DES  HAT (Half-A-TPR) repeat
IPR  IPR003107
ANO  3
ALN  33
AID  0.616858
APH  (O16376_CAEEL/201-233:0.41555,CWF4_SCHPO/185-216:0.50764,CRN_DROME/191-222:0.00000);
ATP  (O16376_CAEEL/201-233,CWF4_SCHPO/185-216,CRN_DROME/191-222);
ATL  0.92319
DNO  3
DLN  99
DID  0.604167
DPH  (O16376_CAEEL/201-233:0.39077,CWF4_SCHPO/185-216:0.33089,CRN_DROME/191-222:0.16515);
DTP  (O16376_CAEEL/201-233,CWF4_SCHPO/185-216,CRN_DROME/191-222);
DTL  0.88681
RID  0.616858
RPH  (O16376_CAEEL/201-233:0.41555,CWF4_SCHPO/185-216:0.50764,CRN_DROME/191-222:0.00000);
RTP  (O16376_CAEEL/201-233,CWF4_SCHPO/185-216,CRN_DROME/191-222);
RTL  0.92319
LNK  CRN_DROME/191-222:P17886:X58374
LNK  CWF4_SCHPO/185-216:P87312:AF254353
LNK  O16376_CAEEL/201-233:O16376:AF016441
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O16376_CAEEL/201-233
ASQ  KEIDRARSVYQRFLHVHGINVQNWIKYAKFEER
DSQ  AAGGAGATTGATCGTGCTCGTTCTGTGTATCAGAGGTTTTTACATGTTCACGGAATTAATGTACAAAACTGGATCAAATACGCCAAGTTTGAAGAACGA
TRN  10110101110011010
NAM  CWF4_SCHPO/185-216
ASQ  HENERARGIYERFVVVH-PEVTNWLRWARFEEE
DSQ  CATGAAAACGAACGGGCTCGTGGCATATATGAACGATTTGTCGTTGTGCAT---CCTGAAGTAACGAATTGGCTTCGTTGGGCTCGTTTTGAAGAAGAA
TRN  10010111110111011
NAM  CRN_DROME/191-222
ASQ  KEIDRAREIYERFVYVH-PDVKNWIKFARFEES
DSQ  AAGGAGATCGACCGGGCACGGGAGATCTACGAGCGATTTGTCTATGTGCAC---CCGGACGTGAAGAACTGGATAAAGTTCGCCCGCTTTGAGGAGTCT
TRN  10010111110111011
//