EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02176 - zf-TRAF)
FAM  PF02176
PID  zf-TRAF
DES  TRAF-type zinc finger
IPR  IPR001293
ANO  14
ALN  60
AID  0.309514
APH  ((((((TRAF6_MOUSE/151-200:1.19166,(((TRAF5_HUMAN/128-181:0.14933,TRAF5_MOUSE/128-181:0.16996):0.20920,TRAF3_HUMAN/136-190:0.72214):0.49186,TRAF4_HUMAN/102-154:0.71784):0.18179):0.13931,TRAF4_HUMAN/156-208:0.79924):0.26128,(((O62248_CAEEL/152-208:0.76024,TRAF3_HUMAN/192-249:0.45741):0.22890,TRAF5_HUMAN/183-239:0.68015):0.17357,TRAF4_HUMAN/210-266:0.90983):0.20338):0.11127,TRAF6_MOUSE/204-258:0.84408):0.31383,DG17_DICDI/194-250:0.61762):0.77651,TRAF2_MOUSE/178-233:0.10216,TRAF2_HUMAN/178-233:0.18536);
ATP  ((((((TRAF6_MOUSE/151-200,(((TRAF5_HUMAN/128-181,TRAF5_MOUSE/128-181),TRAF3_HUMAN/136-190),TRAF4_HUMAN/102-154)),TRAF4_HUMAN/156-208),(((O62248_CAEEL/152-208,TRAF3_HUMAN/192-249),TRAF5_HUMAN/183-239),TRAF4_HUMAN/210-266)),TRAF6_MOUSE/204-258),DG17_DICDI/194-250),TRAF2_MOUSE/178-233,TRAF2_HUMAN/178-233);
ATL  11.3979
DNO  14
DLN  180
DID  0.428401
DPH  (((DG17_DICDI/194-250:0.59202,TRAF6_MOUSE/204-258:0.35577):0.07381,(O62248_CAEEL/152-208:0.60080,(TRAF5_HUMAN/183-239:0.40254,(TRAF3_HUMAN/192-249:0.26964,TRAF6_MOUSE/151-200:0.60544):0.12300):0.08224):0.18244):0.19912,((((TRAF5_HUMAN/128-181:0.20673,TRAF5_MOUSE/128-181:0.09620):0.27463,TRAF3_HUMAN/136-190:0.46836):0.15976,TRAF4_HUMAN/102-154:0.60203):0.17368,TRAF4_HUMAN/156-208:0.60966):0.08842,(TRAF4_HUMAN/210-266:0.50430,(TRAF2_MOUSE/178-233:0.11533,TRAF2_HUMAN/178-233:0.12413):0.33418):0.01058);
DTP  (((DG17_DICDI/194-250,TRAF6_MOUSE/204-258),(O62248_CAEEL/152-208,(TRAF5_HUMAN/183-239,(TRAF3_HUMAN/192-249,TRAF6_MOUSE/151-200)))),((((TRAF5_HUMAN/128-181,TRAF5_MOUSE/128-181),TRAF3_HUMAN/136-190),TRAF4_HUMAN/102-154),TRAF4_HUMAN/156-208),(TRAF4_HUMAN/210-266,(TRAF2_MOUSE/178-233,TRAF2_HUMAN/178-233)));
DTL  7.18382
RID  0.309514
RPH  ((((((TRAF6_MOUSE/151-200:1.19166,(((TRAF5_HUMAN/128-181:0.14933,TRAF5_MOUSE/128-181:0.16996):0.20920,TRAF3_HUMAN/136-190:0.72214):0.49186,TRAF4_HUMAN/102-154:0.71784):0.18179):0.13931,TRAF4_HUMAN/156-208:0.79924):0.26128,(((O62248_CAEEL/152-208:0.76024,TRAF3_HUMAN/192-249:0.45741):0.22890,TRAF5_HUMAN/183-239:0.68015):0.17357,TRAF4_HUMAN/210-266:0.90983):0.20338):0.11127,TRAF6_MOUSE/204-258:0.84408):0.31383,DG17_DICDI/194-250:0.61762):0.77651,TRAF2_MOUSE/178-233:0.10216,TRAF2_HUMAN/178-233:0.18536);
RTP  ((((((TRAF6_MOUSE/151-200,(((TRAF5_HUMAN/128-181,TRAF5_MOUSE/128-181),TRAF3_HUMAN/136-190),TRAF4_HUMAN/102-154)),TRAF4_HUMAN/156-208),(((O62248_CAEEL/152-208,TRAF3_HUMAN/192-249),TRAF5_HUMAN/183-239),TRAF4_HUMAN/210-266)),TRAF6_MOUSE/204-258),DG17_DICDI/194-250),TRAF2_MOUSE/178-233,TRAF2_HUMAN/178-233);
RTL  11.3979
LNK  DG17_DICDI/194-250:P11467:M18106
LNK  O62248_CAEEL/152-208:O62248:Z93382
LNK  TRAF2_HUMAN/178-233:Q12933:U12597
LNK  TRAF2_MOUSE/178-233:P39429:L35303
LNK  TRAF3_HUMAN/136-190:Q13114:U21092
LNK  TRAF3_HUMAN/192-249:Q13114:U21092
LNK  TRAF4_HUMAN/102-154:Q9BUZ4:X80200
LNK  TRAF4_HUMAN/156-208:Q9BUZ4:BC001769
LNK  TRAF4_HUMAN/210-266:Q9BUZ4:X80200
LNK  TRAF5_HUMAN/128-181:O00463:AB000509
LNK  TRAF5_HUMAN/183-239:O00463:AB000509
LNK  TRAF5_MOUSE/128-181:P70191:D78141
LNK  TRAF6_MOUSE/151-200:P70196:D84655
LNK  TRAF6_MOUSE/204-258:P70196:D84655
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TRAF6_MOUSE/151-200
ASQ  HQV-HCEFALVNCPQ--CQ-RPFQKCQVNTHIIEDCPRRQVSCVN----CAVSMAYEE--
DSQ  CATCAAGTA---CATTGTGAATTTGCTCTAGTGAATTGTCCCCAG------TGCCAA---CGTCCTTTCCAGAAGTGCCAGGTTAATACACACATTATTGAGGATTGTCCCAGGAGGCAGGTTTCTTGTGTAAAC------------TGTGCTGTGTCCATGGCATATGAAGAG------
TRN  10010101110011011
NAM  TRAF6_MOUSE/204-258
ASQ  HDQ-SCPLANIICEY--CG-TILIREQMPNHYDLDCPTAPIPCTFSVFGCHQKMQRNHL-
DSQ  CATGATCAA---AGCTGTCCTCTGGCAAATATCATCTGTGAATAC------TGTGGT---ACAATCCTCATCAGAGAACAGATGCCTAATCATTATGATCTGGACTGCCCAACAGCTCCAATCCCTTGCACATTCAGTGTTTTTGGCTGTCATCAAAAGATGCAGAGGAATCACTTG---
TRN  10010101100011011
NAM  DG17_DICDI/194-250
ASQ  HYK-TCPMVPIDCSQ-GCS-VKIERKSIIDHIENDCCNTQIPCKYFEQGCKVEMKRSELQ
DSQ  CATTATAAG---ACATGTCCTATGGTTCCAATTGATTGCTCACAA---GGTTGTTCA---GTGAAAATTGAAAGGAAATCAATTATCGATCATATTGAAAATGATTGTTGTAATACTCAAATACCATGTAAATATTTTGAACAAGGTTGTAAAGTTGAGATGAAGAGATCAGAATTACAA
TRN  10010101110011000
NAM  TRAF2_HUMAN/178-233
ASQ  HHE-VCPKFPLTCDG--CGKKKIPREKFQDHVKT-CGKCRVPCRFHAIGCLETVEGEKQQ
DSQ  CACCACGAG---GTCTGCCCCAAGTTCCCCTTAACTTGTGACGGC------TGCGGCAAGAAGAAGATCCCCCGGGAGAAGTTTCAGGACCACGTCAAGACT---TGTGGCAAGTGTCGAGTCCCTTGCAGATTCCACGCCATCGGCTGCCTCGAGACGGTAGAGGGTGAGAAACAGCAG
TRN  10010101110011010
NAM  TRAF2_MOUSE/178-233
ASQ  HYE-VCPKFPLTCDG--CGKKKIPRETFQDHVRA-CSKCRVLCRFHTVGCSEMVETENLQ
DSQ  CACTATGAG---GTCTGCCCCAAGTTTCCCTTAACCTGTGATGGC------TGTGGCAAGAAGAAGATCCCTCGGGAGACGTTTCAGGACCATGTTAGAGCA---TGCAGCAAATGCCGGGTTCTCTGCAGATTCCACACCGTTGGCTGTTCAGAGATGGTGGAGACTGAGAACCTGCAG
TRN  10010101100011000
NAM  TRAF4_HUMAN/210-266
ASQ  HQY-QCPRLPVACPN-QCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAM-
DSQ  CACCAGTAC---CAGTGCCCAAGGCTGCCTGTTGCCTGCCCCAAC---CAATGTGGTGTGGGCACTGTGGCTCGGGAGGACCTGCCAGGCCATCTGAAGGACAGCTGTAACACCGCCCTGGTGCTCTGCCCATTCAAAGACTCCGGCTGCAAGCACAGGTGCCCTAAGCTGGCAATG---
TRN  10010101100011011
NAM  TRAF5_HUMAN/183-239
ASQ  HEENLCPEYPVFCPN-NCA-KIILKTEVDEHLAV-CPEAEQDCPFKHYGCAVTDKRRNLQ
DSQ  CATGAGGAAAACTTGTGTCCTGAATACCCAGTATTTTGTCCCAAC---AATTGTGCG---AAGATTATTCTAAAAACTGAGGTAGATGAACACCTGGCTGTA---TGTCCTGAAGCTGAGCAAGACTGTCCTTTTAAGCACTATGGCTGTGCTGTAACGGATAAACGGAGGAACCTGCAG
TRN  10010101100011011
NAM  TRAF3_HUMAN/192-249
ASQ  HEDTDCPCVVVSCPH-KCSVQTLLRSELSAHLSE-CVNAPSTCSFKRYGCVFQGTNQQIK
DSQ  CACGAAGACACCGACTGTCCCTGCGTGGTGGTGTCCTGCCCTCAC---AAGTGCAGCGTCCAGACTCTCCTGAGGAGCGAGTTGAGTGCACACTTGTCAGAG---TGTGTCAATGCCCCCAGCACCTGTAGTTTTAAGCGCTATGGCTGCGTTTTTCAGGGGACAAACCAGCAGATCAAG
TRN  10010101100011001
NAM  O62248_CAEEL/152-208
ASQ  HPK-TCPQVIISCPF-QCGLTDRPRLEIEAHCPS-CPNVDNVCPFVPYGCTFAGGKESIQ
DSQ  CATCCAAAG---ACCTGTCCTCAAGTTATCATCAGCTGCCCATTC---CAGTGCGGTCTCACCGACCGCCCACGTCTCGAGATCGAAGCTCATTGTCCCAGC---TGTCCAAATGTTGACAACGTGTGCCCATTTGTACCATATGGATGCACGTTTGCAGGAGGAAAAGAGTCAATTCAA
TRN  11011101111011001
NAM  TRAF4_HUMAN/102-154
ASQ  HLN-TCSFNVIPCPN-RCP-MKLSRRDLPAHLQHDCPKRRLKCEF----CGCDFSGEAYE
DSQ  CACCTGAAT---ACCTGCAGCTTCAATGTCATTCCCTGCCCTAAT---CGCTGCCCC---ATGAAGCTGAGCCGCCGTGATCTACCTGCACACTTGCAGCATGACTGCCCCAAGCGGCGCCTCAAGTGCGAGTTT------------TGTGGCTGTGACTTCAGTGGGGAGGCCTATGAG
TRN  11011111101111111
NAM  TRAF3_HUMAN/136-190
ASQ  HLKNDCHFEELPCVRPDCK-EKVLRKDLRDHVEKACKYREATCSH----CKSQVPMIALQ
DSQ  CATTTAAAAAATGATTGCCATTTTGAAGAACTTCCATGTGTGCGTCCTGACTGCAAA---GAAAAGGTCTTGAGGAAAGACCTGCGAGACCACGTGGAGAAGGCGTGTAAATACCGGGAAGCCACATGCAGCCAC------------TGCAAGAGTCAGGTTCCGATGATCGCGCTGCAG
TRN  10010101100011010
NAM  TRAF5_MOUSE/128-181
ASQ  HLQ-HCSFQAVPCPNESCR-EAMLRKDVKEHLSAYCRFREEKCLY----CKRDIVVTNLQ
DSQ  CACCTTCAG---CACTGTTCCTTCCAAGCCGTGCCCTGCCCTAACGAGAGCTGCCGG---GAAGCCATGCTCCGGAAAGACGTGAAAGAGCACCTGAGCGCATACTGCCGGTTCCGAGAGGAGAAGTGCCTTTAC------------TGCAAAAGGGACATAGTGGTGACCAACCTGCAG
TRN  10010101100011011
NAM  TRAF5_HUMAN/128-181
ASQ  HLQ-QCLFQPVQCSNEKCR-EPVLRKDLKEHLSASCQFRKEKCLY----CKKDVVVINLQ
DSQ  CACCTTCAG---CAGTGCTTATTTCAACCTGTGCAGTGTTCTAATGAGAAGTGCCGG---GAGCCAGTCCTACGGAAAGACCTGAAAGAGCATTTGAGTGCATCCTGTCAGTTTCGAAAGGAAAAATGCCTTTAT------------TGCAAAAAGGATGTGGTAGTCATCAATCTACAG
TRN  11011101101011010
NAM  TRAF4_HUMAN/156-208
ASQ  HEG-MCPQESVYCEN-KCG-ARMMRRLLAQHATSECPKRTQPCTY----CTKEFVFDTIQ
DSQ  CATGAGGGT---ATGTGCCCCCAGGAGAGTGTCTACTGTGAGAAT---AAGTGTGGT---GCCCGCATGATGCGGCGGCTGCTGGCCCAGCATGCCACCTCTGAGTGCCCCAAGCGCACTCAGCCCTGCACCTAC------------TGCACTAAGGAGTTCGTCTTTGACACCATCCAG
TRN  11011111101111111
//