EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02144 - Rad1)
FAM  PF02144
PID  Rad1
DES  Repair protein Rad1/Rec1/Rad17
IPR  IPR003021
ANO  3
ALN  180
AID  0.296373
APH  (REC1_USTMA/239-418:1.13146,O70452_MOUSE/109-257:0.52338,RAD1_SCHPO/113-263:1.06499);
ATP  (REC1_USTMA/239-418,O70452_MOUSE/109-257,RAD1_SCHPO/113-263);
ATL  2.71983
DNO  3
DLN  540
DID  0.396551
DPH  (REC1_USTMA/239-418:0.68052,O70452_MOUSE/109-257:0.50324,RAD1_SCHPO/113-263:0.69558);
DTP  (REC1_USTMA/239-418,O70452_MOUSE/109-257,RAD1_SCHPO/113-263);
DTL  1.87934
RID  0.296373
RPH  (REC1_USTMA/239-418:1.13146,O70452_MOUSE/109-257:0.52338,RAD1_SCHPO/113-263:1.06499);
RTP  (REC1_USTMA/239-418,O70452_MOUSE/109-257,RAD1_SCHPO/113-263);
RTL  2.71983
LNK  O70452_MOUSE/109-257:O70452:AF058394
LNK  RAD1_SCHPO/113-263:P22193:Z28385
LNK  REC1_USTMA/239-418:P14746:X17663
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  REC1_USTMA/239-418
ASQ  KLSYQGHGNPLVLELEQDANVLTRVSMSTYEPSFLTDMVFEPQNMVAQVIVASELMQSAFTEIDASCKKLSILITSPHSLSTYDGDQRTEAPAPTKRNTSASMLKFRAISDTGSSQMEFPASLTSSDPTGVIEKFVALPGSSEQWYDFTLLSRTMSVLRSSIKTSLRMDEAGLISFQFMM
DSQ  AAACTCAGCTATCAAGGTCATGGTAATCCACTCGTTCTCGAGCTTGAGCAAGACGCCAACGTATTGACGCGTGTATCTATGTCGACATACGAACCCAGCTTCCTCACAGATATGGTCTTTGAACCGCAGAATATGGTGGCTCAAGTCATTGTTGCATCCGAGCTCATGCAATCTGCCTTTACTGAGATTGATGCCAGCTGCAAGAAACTCTCGATCCTCATCACATCGCCCCACTCATTATCGACGTATGACGGTGATCAGCGCACAGAGGCTCCGGCACCCACCAAGAGGAACACTTCAGCCAGCATGCTCAAGTTCAGGGCCATCTCGGATACCGGATCGTCACAAATGGAGTTCCCAGCCAGTCTCACCTCATCTGACCCTACGGGCGTTATAGAGAAATTCGTAGCCCTGCCTGGCAGCAGCGAACAATGGTACGACTTCACATTGCTCTCACGAACCATGTCTGTCTTGCGATCGTCGATAAAGACCTCTCTCCGAATGGACGAGGCTGGTCTCATTAGCTTTCAGTTTATGATG
TRN  10010101100011000
NAM  O70452_MOUSE/109-257
ASQ  RMCYQGYGHPLMLFLEEGG-VVTVCKITTQEPEETLDFDFCSTNVMNKIILQSEGLREAFSELDMTGDVLQITVSPDKPYFRLS----------TFGNAGNSHLDYPKDSDLVEAFHCDKTQVN--------------------RYKLSLLKPSTKALALSCKVSIRTDNRGFLSLQYMI
DSQ  CGGATGTGTTACCAAGGTTATGGTCACCCACTGATGCTATTTCTAGAAGAAGGAGGA---GTGGTGACGGTCTGCAAAATTACCACTCAGGAGCCTGAGGAGACACTGGATTTTGATTTCTGCAGCACCAATGTTATGAATAAAATTATCCTGCAGTCAGAGGGGCTCCGGGAAGCCTTTTCTGAGCTGGACATGACAGGTGATGTCCTACAGATCACTGTGTCTCCTGACAAGCCCTATTTCAGGTTGTCT------------------------------ACTTTTGGAAATGCAGGAAACTCCCATCTTGACTATCCCAAAGATTCCGACTTGGTGGAAGCCTTTCACTGTGATAAGACCCAGGTCAAC------------------------------------------------------------AGATACAAGCTGTCGCTACTGAAGCCTTCTACAAAGGCACTAGCTTTATCCTGTAAAGTGTCTATCCGGACAGATAACCGAGGCTTCCTCTCCTTACAGTACATGATT
TRN  10010101100011000
NAM  RAD1_SCHPO/113-263
ASQ  KVQYNGPGCPFIWEVEEMAGYATACELLTMECEDDVDINRLASTLCTKIIMKSNWLYDALVELDNNMGENLIIHTSSQKSTFLLR---------CVGALSTTEIEYPNEKSVLESFETDSENTY--------------------SYRFSLIRHALKALQVGSKVNLRIDENGTLSIQIML
DSQ  AAAGTACAGTATAATGGACCCGGCTGTCCATTTATATGGGAAGTAGAGGAAATGGCTGGTTATGCTACGGCTTGTGAACTGTTGACTATGGAATGTGAGGACGACGTTGACATCAATAGACTTGCAAGCACATTGTGCACGAAGATCATTATGAAAAGTAACTGGCTATATGATGCCTTGGTGGAATTAGACAATAACATGGGCGAAAATTTAATTATTCATACATCATCCCAAAAATCAACCTTCTTATTGAGA---------------------------TGTGTAGGGGCATTATCCACTACGGAAATAGAATATCCAAACGAGAAAAGTGTTTTAGAGTCTTTTGAAACTGATTCTGAAAACACTTAT------------------------------------------------------------TCCTACCGCTTCTCATTAATAAGACATGCGCTGAAAGCATTACAAGTGGGTTCTAAAGTAAACCTACGTATTGATGAAAATGGAACTTTGAGCATTCAAATCATGCTT
TRN  10010101100011000
//