EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02091 - tRNA-synt_2e)
FAM  PF02091
PID  tRNA-synt_2e
DES  Glycyl-tRNA synthetase alpha subunit
IPR  IPR002310
ANO  9
ALN  290
AID  0.610239
APH  ((SYGA_BACSU/3-286:0.23174,SYGA_SYNY3/5-288:0.26261):0.04295,(((SYG_CHLPN/8-291:0.10116,SYG_CHLTR/8-291:0.12160):0.31794,O23150_ARATH/73-356:0.34387):0.05866,SYGA_HELPY/4-291:0.38866):0.07440,((SYGA_MORCA/9-296:0.13133,SYGA_ECOLI/9-298:0.17078):0.03417,SYGA_COXBU/9-296:0.14542):0.12769);
ATP  ((SYGA_BACSU/3-286,SYGA_SYNY3/5-288),(((SYG_CHLPN/8-291,SYG_CHLTR/8-291),O23150_ARATH/73-356),SYGA_HELPY/4-291),((SYGA_MORCA/9-296,SYGA_ECOLI/9-298),SYGA_COXBU/9-296));
ATL  2.55298
DNO  9
DLN  870
DID  0.590124
DPH  (((((SYGA_HELPY/4-291:0.37372,SYGA_BACSU/3-286:0.25750):0.07186,SYGA_SYNY3/5-288:0.26383):0.05662,(SYGA_MORCA/9-296:0.20137,(SYGA_ECOLI/9-298:0.26612,SYGA_COXBU/9-296:0.18148):0.05863):0.08418):0.08442,O23150_ARATH/73-356:0.36025):0.21228,SYG_CHLPN/8-291:0.17304,SYG_CHLTR/8-291:0.18906);
DTP  (((((SYGA_HELPY/4-291,SYGA_BACSU/3-286),SYGA_SYNY3/5-288),(SYGA_MORCA/9-296,(SYGA_ECOLI/9-298,SYGA_COXBU/9-296))),O23150_ARATH/73-356),SYG_CHLPN/8-291,SYG_CHLTR/8-291);
DTL  2.83436
RID  0.610239
RPH  ((SYGA_BACSU/3-286:0.23174,SYGA_SYNY3/5-288:0.26261):0.04295,(((SYG_CHLPN/8-291:0.10116,SYG_CHLTR/8-291:0.12160):0.31794,O23150_ARATH/73-356:0.34387):0.05866,SYGA_HELPY/4-291:0.38866):0.07440,((SYGA_MORCA/9-296:0.13133,SYGA_ECOLI/9-298:0.17078):0.03417,SYGA_COXBU/9-296:0.14542):0.12769);
RTP  ((SYGA_BACSU/3-286,SYGA_SYNY3/5-288),(((SYG_CHLPN/8-291,SYG_CHLTR/8-291),O23150_ARATH/73-356),SYGA_HELPY/4-291),((SYGA_MORCA/9-296,SYGA_ECOLI/9-298),SYGA_COXBU/9-296));
RTL  2.55298
LNK  O23150_ARATH/73-356:O23150:AJ003069
LNK  SYGA_BACSU/3-286:P54380:D84432
LNK  SYGA_COXBU/9-296:P94616:Y10435
LNK  SYGA_ECOLI/9-298:P00960:U00039
LNK  SYGA_HELPY/4-291:P56453:AE000604
LNK  SYGA_MORCA/9-296:P77892:U73324
LNK  SYGA_SYNY3/5-288:Q55716:D64002
LNK  SYG_CHLPN/8-291:Q9Z6W0:AE002250
LNK  SYG_CHLTR/8-291:Q46371:AE001352
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SYGA_SYNY3/5-288
ASQ  FQAVIAKLNEFWAQQGCLIAQPFDTEKGAGTMNPHTFLRAIGPEPWSVAYVEPCRRPTDGRYGENPNRVQHYFQYQVLIKPSPDNIQEVYLDSLRALGIQPEDHDIRFVEDNWESPTLGAWGVGWEVWLDGMEVTQFTYFQQCGGIDCRPVSIEITYGLERLAMYLQNVEAIDQIQWNEK----LSYGDIFWQGEVEQCTYNFEASNPDLLFQLFALYEQEAGQLIERG..LALPSLEYVLKCSHAFNLLDARGVIAVTERTRYIGRIRNLAREVAHIYLQQREALGFPL
DSQ  TTCCAAGCTGTTATCGCCAAGTTGAACGAATTTTGGGCCCAGCAAGGTTGCCTCATTGCCCAACCCTTTGACACGGAAAAAGGCGCTGGCACCATGAATCCCCACACCTTTCTACGGGCGATCGGGCCGGAACCTTGGTCAGTGGCCTATGTGGAGCCCTGTCGCCGGCCCACCGATGGCCGCTATGGAGAAAATCCCAACCGGGTACAGCACTATTTCCAGTATCAGGTGTTAATTAAGCCTTCCCCGGACAATATTCAGGAAGTGTATCTTGATTCCCTACGGGCCCTGGGTATTCAGCCCGAGGATCACGACATTCGTTTTGTGGAAGATAACTGGGAATCCCCAACCCTGGGGGCCTGGGGCGTAGGCTGGGAAGTGTGGCTCGACGGCATGGAAGTGACCCAATTTACCTATTTTCAGCAATGTGGTGGCATTGACTGTCGCCCCGTTTCCATCGAGATTACCTATGGCTTGGAACGGTTGGCCATGTATCTGCAAAATGTGGAGGCGATCGACCAAATTCAGTGGAATGAAAAG------------CTCAGCTACGGGGATATTTTCTGGCAGGGAGAAGTAGAGCAGTGTACCTATAATTTTGAAGCGTCTAACCCCGATTTATTATTTCAATTGTTTGCCCTTTACGAACAGGAAGCAGGGCAGTTAATCGAACGGGGT......TTAGCTTTGCCCAGTTTGGAATATGTCCTGAAATGCTCCCATGCGTTTAATTTACTCGACGCGAGGGGAGTAATTGCCGTGACTGAGCGCACCCGTTACATTGGTCGCATTCGTAACTTGGCTAGGGAAGTGGCCCATATTTATTTACAACAACGGGAAGCCCTAGGTTTTCCCTTG
TRN  10010101100011000
NAM  SYGA_BACSU/3-286
ASQ  IQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGPEPWKVAYVEPSRRPADGRYGENPNRLYQHHQFQVIIKPSPDNIQELYLDSLRALGIDPLEHDIRFVEDNWENPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYGIERLASYIQDKENVFDLEWTSG----FTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIKQMDNG..LVHPAYDYVLKCSHTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREKLGFPM
DSQ  ATTCAAGACATGATTCTAACCTTGCAAAAGCATTGGTCCAGTCAGGGCTGTGTGCTTATGCAGGCTTACGATGTAGAAAAAGGAGCCGGCACGATGAGCCCGTATACATTTTTGCGCAGTATCGGTCCTGAGCCGTGGAAAGTGGCTTATGTAGAGCCTTCCAGACGTCCGGCAGACGGCCGCTACGGGGAGAACCCGAACAGACTGTATCAGCATCATCAGTTCCAGGTCATTATTAAACCGTCACCTGATAACATTCAAGAGCTGTATTTGGATTCCTTGCGTGCTCTTGGAATTGATCCGCTTGAGCACGATATTCGCTTTGTTGAAGACAACTGGGAGAATCCGTCTTTAGGCTGCGCGGGTCTAGGCTGGGAAGTTTGGCTTGACGGAATGGAAATAACACAATTTACGTATTTCCAGCAGGTCGGGGGATTAGAGTGTAAACCCGTTTCTGTAGAGATTACGTATGGAATTGAGCGTCTCGCGTCTTATATCCAGGATAAAGAAAACGTGTTTGACTTGGAATGGACGTCAGGG------------TTTACAGTAAAAGATTTATTCATGATGGCTGAATATGAGCATTCTGTTTATACGTTTGAAACATCAGACGTCGATATGCTGTTCCAATTGTTCAGCACATATGAAAAAGAAGCGATCAAGCAAATGGACAACGGA......CTTGTTCATCCAGCATATGACTATGTGCTGAAATGCTCGCACACTTTCAACCTGCTTGATGCCAAAGGTGCGATCTCTGTTACCGAGCGGACGGGCTATATCGCAAGAGTGCGGAATTTAGCTAGAAAAGTAGCAAAAACCTACTATGAGGAACGAGAAAAACTAGGGTTCCCAATG
TRN  10010101100011000
NAM  SYGA_COXBU/9-296
ASQ  FQQMILALQEYWASQGCVLLQPFDMEVGAGTFHPATFLRAIGPEPWRAAYVQPSRRPTDGRYGDNPNRTQHYYQFQVVLKPSPDDIQDIYLGSLKALGIDPLTHDIRFVEDNWEAPTLGSWGVGWEVWQDGMEITQFTYFQQIGGLECKPVTGEITYGLERLAMFLQGIDNMFDLVWTEGPNGRVTYGQIFQQNEVEMSAYNFEYANVEALFNFFDFYEKEASQLIEVH..LPLAAYEMVLKASHTFNLLDARQAISVTERQRFILRVRKLAQAVAEAYYSAREKLGFPM
DSQ  TTCCAACAAATGATTCTCGCTTTACAGGAATATTGGGCCTCCCAAGGATGTGTCTTGTTACAACCTTTCGATATGGAAGTAGGCGCTGGGACTTTCCATCCCGCAACCTTTTTGCGAGCCATCGGTCCTGAACCCTGGCGCGCTGCCTATGTCCAACCTTCGCGCCGACCAACCGACGGGCGCTACGGAGATAATCCCAATCGCACCCAGCATTACTATCAATTTCAAGTCGTCTTGAAGCCATCCCCCGATGACATTCAAGATATCTATTTGGGTTCTCTAAAAGCGCTGGGTATTGATCCGCTCACTCATGACATTCGTTTTGTCGAAGACAATTGGGAGGCGCCTACACTAGGCTCCTGGGGAGTCGGTTGGGAAGTTTGGCAAGATGGAATGGAAATTACACAATTCACGTACTTCCAACAAATCGGCGGCTTAGAATGCAAACCCGTCACTGGGGAAATTACTTATGGCCTGGAACGTCTGGCTATGTTTCTGCAAGGGATAGATAACATGTTTGACCTTGTCTGGACCGAAGGCCCTAACGGACGCGTCACCTATGGACAAATTTTCCAACAAAATGAAGTTGAAATGTCAGCCTACAATTTCGAATACGCCAATGTAGAAGCATTATTTAATTTTTTCGATTTTTACGAAAAGGAAGCAAGCCAATTAATTGAAGTTCAC......TTACCGCTAGCGGCTTATGAGATGGTGCTAAAAGCCTCTCATACCTTTAATCTTCTCGATGCTCGCCAAGCCATTTCTGTGACAGAACGCCAACGGTTTATCCTCCGCGTCAGAAAACTGGCCCAAGCCGTTGCCGAAGCCTATTATTCCGCTCGAGAAAAACTTGGGTTTCCAATG
TRN  10010101100011000
NAM  SYGA_ECOLI/9-298
ASQ  FQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRELGPEPMAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEnpLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPM
DSQ  TTCCAGGGCTTGATCCTGACCTTACAGGATTACTGGGCTCGCCAGGGCTGCACCATTGTTCAACCATTGGACATGGAAGTCGGCGCGGGAACCTCTCACCCAATGACCTGTCTGCGCGAGCTGGGGCCAGAACCGATGGCGGCTGCTTATGTTCAGCCTTCTCGTCGCCCGACCGATGGTCGCTACGGCGAAAACCCCAACCGTTTACAGCACTACTATCAGTTCCAGGTGGTCATTAAGCCATCGCCGGACAATATTCAGGAGCTGTACCTCGGTTCTCTGAAAGAGCTGGGCATGGACCCGACTATTCACGACATCCGTTTCGTGGAAGATAACTGGGAAAACCCGACGCTGGGTGCCTGGGGACTGGGCTGGGAAGTGTGGCTGAACGGCATGGAAGTGACGCAGTTCACTTACTTCCAGCAGGTTGGTGGTCTGGAGTGTAAACCGGTTACCGGCGAGATCACCTACGGTCTGGAACGTCTGGCCATGTACATTCAGGGCGTAGACAGCGTTTACGACCTGGTCTGGAGCGACGGCCCGCTGGGTAAAACCACCTACGGCGACGTGTTCCATCAGAACGAAGTGGAGCAGTCCACTTACAACTTCGAATACGCGGATGTGGACTTCCTGTTCACCTGCTTCGAGCAGTACGAGAAAGAAGCGCAGCAGCTGCTGGCGCTGGAAaatccgCTGCCGCTGCCAGCCTACGAGCGTATTCTGAAAGCCGCCCACAGCTTCAACCTGCTGGATGCGCGTAAAGCCATCTCCGTCACCGAGCGTCAGCGCTACATTCTGCGCATTCGCACCCTGACCAAAGCAGTGGCAGAAGCATACTACGCTTCCCGTGAAGCCCTCGGCTTCCCGATG
TRN  11011101101011010
NAM  SYGA_MORCA/9-296
ASQ  FQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNTAYVQPSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSVYDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVN..LPLPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARAKLGFPL
DSQ  TTTCAAGCACTGATTTTAACACTGCAAAATTATTGGGCATCTCGTGGCTGTGTGGTGCTGCAGCCTTATGATATGGAAGTGGGGGCTGGGACATTTCACACCGCCACTTTTTTGCGTGCCTTAACCCCCGAGCGTTGGAATACAGCTTATGTTCAGCCATCTCGCCGTCCAACCGATGGGCGTTATGGTGATAATCCCAATCGCTTACAACACTATTACCAATTTCAAGTGGTGTTAAAGCCCAATCCTGCCAACATTCAAGAGCTGTATTTAGGCTCTTTAAAAGCCATTGGCATTGATACGCTGACCCATGATGTCCGCTTTGTTGAAGACAATTGGGAGAGTCCAACGCTTGGGGCGTGGGGGCTTGGCTGGGAAGTATGGCTAAATGGCATGGAAGTTACCCAGTTTACCTATTTTCAGCAGGTTGGTGGCATTGAGTGCTTCCCTGTGACAGGTGAGATTACCTATGGGCTTGAGCGCCTTGCCATGTATATCCAAGGCGTGGACAGTGTGTATGATTTGGTGTGGGCAGATGGTGAATTTGGGCGTGTGACTTATGGTGATGTGTTCCATCAAAATGAAGTGGAGCAATCCGCCTATAATTTTGAACATGCCGATGTGGCTAAATTGTTTGAATTATTTGATTTTTATGAAGAGCAAGCAGATAAGTTGGTTGCGGTCAAT......TTACCCTTGCCTGCTTATGAGATGGTGTTAAAAGCCAGTCATGCCTTTAACCTATTGGACGCTCGTGGGGCGATTAGCGTTACCGAACGCCAACGCTTTATCTTGCGTGTACGCACACTGGCCCGCAAAGTGGCAATCAGCTATACCGAAGCTCGGGCAAAATTGGGCTTTCCTTTG
TRN  11011101101011010
NAM  SYGA_HELPY/4-291
ASQ  FSSLLLKLQEYWKNQGCLVIQPYDIPAGAGTFHPATLLRSLDKKPWNVAYVAPSRRPTDGRYGENPNRLGSYYQFQVVIKPSPSNIQELYLKSLEVLGINLNEHDIRFVEDNWESPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGIACSPIPVEITYGLERLAMYVQKVENILEIEWAKKNHDSVNYAQVHLESEYEFSKYHFETASVKRLLEMFKNAQAEALHCLENK..LPLPAYDFVMLCSHFFNILDARKAISVAERQNYILQIRDLAKGCALLYKEQEEEREERL
DSQ  TTTTCAAGTTTATTATTAAAACTACAAGAGTATTGGAAGAATCAAGGCTGTTTGGTGATCCAGCCTTATGATATTCCTGCAGGAGCTGGGACATTCCATCCGGCCACGCTTTTAAGGAGTTTGGATAAAAAGCCGTGGAATGTGGCGTATGTCGCGCCCTCTAGAAGGCCTACTGATGGGCGCTATGGGGAAAACCCTAACCGCTTGGGGAGTTATTACCAATTCCAAGTAGTCATCAAGCCCAGCCCTTCTAATATCCAGGAACTCTATTTAAAAAGCTTAGAAGTGTTAGGGATAAACCTTAATGAGCATGATATACGATTTGTAGAAGACAATTGGGAGAGTCCGACTTTAGGGGCATGGGGGCTTGGCTGGGAAGTGTGGCTTGATGGCATGGAAGTTACGCAATTCACTTATTTCCAGCAAGTGGGGGGCATTGCTTGTAGCCCTATTCCTGTAGAGATCACTTACGGCTTAGAAAGATTAGCGATGTATGTGCAAAAAGTGGAAAATATCCTAGAGATTGAATGGGCTAAAAAAAATCATGACAGCGTGAATTACGCACAAGTGCATTTGGAAAGCGAATACGAATTCAGCAAGTATCATTTTGAAACAGCGAGCGTGAAACGGCTATTAGAAATGTTTAAAAACGCTCAAGCCGAAGCCTTGCATTGCTTGGAAAACAAG......CTCCCCTTGCCGGCTTATGATTTTGTGATGTTATGCTCGCATTTTTTCAATATTTTAGACGCCAGAAAAGCGATTTCGGTGGCTGAAAGGCAAAATTATATTTTACAAATCAGGGATTTAGCCAAAGGGTGTGCGCTTCTTTATAAAGAACAAGAAGAAGAGAGGGAAGAGCGTTTA
TRN  10010101110011000
NAM  O23150_ARATH/73-356
ASQ  FQQAIQRLQEYWASVGCAVMQPSNTEVGAGTMNPCTFLRVLGPEPWNVAYVEPSIRPDDSRYGENPNRLQRHTQFQVILKPDPGNSQQLFINSLSALGIDVTAHDIRFVEDNWESPVLGAWGLGWEIWMDGMEITQFTYFQQAGSLPLSPVSVEITYGLERIIMLLQEVDHFKKILYADGI----TYGELFLENEKEMSSYYLEHASVDRLQKHFDYFDEEARSLLALG..LPIPAYDQLLKTSHAFNILDARGFIGVTERARYFGRMRTLARQCAQLWLATRESLGHPL
DSQ  TTCCAACAAGCGATTCAACGCCTCCAGGAATATTGGGCTTCCGTTGGATGTGCCGTTATGCAACCAAGTAACACTGAGGTCGGAGCTGGCACCATGAATCCTTGTACCTTTTTGAGGGTTCTTGGTCCTGAACCATGGAATGTTGCTTATGTTGAGCCAAGCATACGTCCTGACGACTCTCGCTATGGAGAGAATCCCAATAGGCTTCAAAGACACACTCAATTTCAAGTCATATTGAAACCTGACCCTGGAAACTCTCAACAGCTCTTTATCAACAGTCTTTCTGCTCTAGGTATTGATGTGACTGCACACGATATACGGTTTGTAGAAGACAACTGGGAGAGCCCGGTGCTTGGTGCTTGGGGGTTGGGCTGGGAGATTTGGATGGATGGTATGGAAATCACACAATTTACTTACTTCCAGCAGGCTGGAAGTCTTCCGTTGTCTCCAGTATCTGTTGAAATAACTTATGGGCTTGAGCGCATCATCATGTTACTTCAGGAAGTTGACCATTTCAAAAAGATCTTATATGCTGATGGAATC------------ACCTATGGGGAGCTTTTCTTGGAAAATGAGAAGGAAATGAGCTCATATTATTTAGAGCATGCTAGTGTGGATCGCCTTCAAAAGCATTTCGATTATTTTGATGAAGAAGCACGTTCCTTGCTTGCCTTAGGA......CTTCCAATCCCTGCGTATGACCAGCTTCTGAAGACATCTCACGCTTTTAACATTTTAGACGCTAGAGGTTTCATTGGCGTAACTGAACGTGCTCGTTATTTCGGTCGAATGCGTACGTTGGCTCGCCAATGTGCCCAACTGTGGTTAGCGACACGTGAGTCTCTTGGACATCCTCTT
TRN  10010101100011000
NAM  SYG_CHLTR/8-291
ASQ  LQTMMAAILNFWSEQGCIIHQGYDLEVGAGTFNPATFLQSLGPEPFRTAYIEPSRRPQDGRYGQHPNRLQKYHQLQVILKPVPENFLSLYLESLKVIGLNLVDHDIRFVHDDWENPTIGAWGLGWEVWLNGMEITQLTYFQAVGSKPLDAISGEITYGVERIAMYLQKKNSVYDVMWNDS----LTYGDITQYAEQAWSQYNFETANTTMWLKHFDDFSAEALATLDQG..LPLPAYDFVIKASHAFNMLDSRGVISVTERTRYIAKIRQLARAAADKYVAWRESLGFPL
DSQ  CTTCAAACCATGATGGCAGCTATTCTAAACTTTTGGAGCGAACAAGGCTGCATCATTCATCAAGGATATGATTTAGAAGTTGGAGCCGGGACATTTAACCCAGCAACCTTTCTGCAATCTTTAGGCCCCGAACCTTTTAGAACAGCTTATATCGAACCTTCTCGGCGCCCGCAAGATGGTCGTTATGGACAACACCCTAATCGATTACAAAAGTACCACCAGTTACAGGTGATCCTCAAACCTGTCCCTGAAAATTTTCTTTCCCTTTACTTAGAATCTCTCAAAGTCATCGGATTAAATTTAGTAGATCATGACATCCGTTTCGTTCACGATGACTGGGAAAATCCTACTATTGGAGCTTGGGGGCTAGGCTGGGAAGTATGGTTAAATGGTATGGAAATTACACAACTGACCTACTTCCAAGCTGTAGGAAGTAAACCTTTAGATGCAATTAGCGGCGAAATTACTTATGGTGTTGAGCGAATCGCTATGTATCTTCAGAAAAAGAACTCCGTCTACGATGTGATGTGGAATGATTCT------------CTTACTTATGGAGACATCACACAGTATGCAGAACAGGCCTGGAGCCAATACAATTTTGAGACTGCCAACACTACCATGTGGTTGAAACATTTTGATGACTTCTCTGCAGAAGCGTTGGCAACTCTAGACCAAGGC......CTCCCTCTCCCAGCATATGATTTCGTCATCAAAGCTTCCCATGCCTTTAATATGCTAGATTCCCGAGGGGTAATTTCTGTGACAGAACGCACGCGGTATATTGCCAAGATACGGCAACTAGCACGAGCTGCTGCAGATAAGTATGTGGCATGGCGGGAGTCATTAGGGTTTCCTCTC
TRN  10010101100011000
NAM  SYG_CHLPN/8-291
ASQ  LQSMIATILRFWSEQGCVIHQGYDLEVGAGTFNPATFLRALGPEPYKAAYVEPSRRPQDGRYGVHPNRLQNYHQLQVILKPVPENFLSLYTESLRAIGLDLRDHDIRFIHDDWENPTIGAWGLGWEVWLNGMEITQLTYFQAIGSKPLDTISGEITYGIERIAMYLQKKTSIYDVLWNDT----LTYGQITQASEKAWSEYNFDYANTEMWFKHFEDFAEEALRTLKNG..LSVPAYDFVIKASHAFNILDARGTISVTERTRYIARIRQLTRLVADSYVEWRASLNYPL
DSQ  TTACAGTCTATGATTGCGACTATCTTACGATTTTGGAGCGAGCAAGGGTGCGTCATCCATCAAGGATACGATTTAGAAGTTGGTGCTGGAACATTCAATCCTGCAACGTTCTTACGAGCCTTAGGACCTGAGCCCTATAAGGCTGCTTATGTAGAACCTTCAAGGCGTCCGCAAGATGGTCGGTATGGCGTGCATCCGAACCGGCTACAAAACTATCATCAACTCCAGGTCATTTTAAAGCCCGTGCCTGAAAATTTTCTCTCACTCTATACGGAATCGCTACGGGCCATTGGTTTAGACCTTCGTGATCACGATATCCGTTTTATTCATGACGATTGGGAAAACCCTACCATTGGAGCTTGGGGCTTAGGTTGGGAAGTGTGGCTCAATGGGATGGAAATTACCCAGTTGACCTATTTCCAAGCCATTGGGAGTAAACCTTTGGATACTATCAGTGGGGAGATCACCTATGGCATTGAAAGAATTGCGATGTATTTGCAAAAGAAAACCTCTATTTATGATGTCTTATGGAATGACACT------------TTAACGTATGGACAAATTACACAAGCTTCTGAAAAAGCTTGGAGTGAATATAATTTTGACTATGCAAACACCGAGATGTGGTTTAAGCATTTCGAAGATTTCGCTGAGGAAGCTTTAAGAACTCTTAAAAATGGT......CTTTCTGTTCCTGCTTATGACTTCGTGATCAAAGCGTCGCATGCTTTTAATATCCTTGATGCTCGGGGAACGATTTCTGTTACTGAGCGTACACGTTATATTGCTCGTATCCGTCAATTAACTCGTTTAGTTGCGGATAGCTATGTAGAGTGGCGTGCTTCTTTAAATTATCCTTTA
TRN  10010101110011000
//