EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02069 - Metallothio_Pro)
FAM  PF02069
PID  Metallothio_Pro
DES  Prokaryotic metallothionein
IPR  IPR000518
ANO  2
ALN  53
AID  0.574468
APH  (MT_SYNVU/1-53:0.78732,MT_SYNP7/1-53:0.03662);
ATP  (MT_SYNVU/1-53,MT_SYNP7/1-53);
ATL  0.82394
DNO  2
DLN  159
DID  0.584906
DPH  (MT_SYNVU/1-53:0.18813,MT_SYNP7/1-53:0.44284);
DTP  (MT_SYNVU/1-53,MT_SYNP7/1-53);
DTL  0.63098
RID  0.574468
RPH  (MT_SYNVU/1-53:0.78732,MT_SYNP7/1-53:0.03662);
RTP  (MT_SYNVU/1-53,MT_SYNP7/1-53);
RTL  0.82394
LNK  MT_SYNP7/1-53:P30331:X64585
LNK  MT_SYNVU/1-53:P30565:X53839
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MT_SYNVU/1-53
ASQ  TTVTQMKCACPHCLCIVSLNDAIMVDGKPYCSEVCANGTCKENSGCGHAGCGC
DSQ  ACAACCGTGACCCAAATGAAATGCGCCTGTCCCCACTGCCTGTGCATCGTCTCCCTCAACGATGCCATTATGGTCGACGGCAAACCCTACTGCTCCGAAGTCTGTGCCAATGGCACCTGCAAAGAGAATAGCGGCTGTGGCCACGCAGGTTGCGGCTGT
TRN  11011101101011011
NAM  MT_SYNP7/1-53
ASQ  TSTTLVKCACEPCLCNVDPSKAIDRNGLYYCSEACADGHTGGSKGCGHTGCNC
DSQ  ACCTCAACAACGTTGGTCAAATGCGCTTGTGAGCCCTGTCTCTGCAACGTCGATCCCAGCAAAGCGATCGATCGCAACGGTCTGTACTACTGCAGCGAAGCCTGTGCCGATGGCCACACCGGTGGTAGCAAAGGCTGCGGCCACACCGGCTGTAACTGC
TRN  11011101101011001
//