EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02035 - Coagulin)
FAM  PF02035
PID  Coagulin
DES  Coagulin
IPR  IPR000275
ANO  2
ALN  174
AID  0.709091
APH  (COAG_LIMPO/23-195:0.28408,COAG_TACTR/23-195:0.09992);
ATP  (COAG_LIMPO/23-195,COAG_TACTR/23-195);
ATL  0.384
DNO  2
DLN  522
DID  0.76938
DPH  (COAG_LIMPO/23-195:0.25519,COAG_TACTR/23-195:0.02581);
DTP  (COAG_LIMPO/23-195,COAG_TACTR/23-195);
DTL  0.281
RID  0.709091
RPH  (COAG_LIMPO/23-195:0.28408,COAG_TACTR/23-195:0.09992);
RTP  (COAG_LIMPO/23-195,COAG_TACTR/23-195);
RTL  0.384
LNK  COAG_LIMPO/23-195:P03998:X04424
LNK  COAG_TACTR/23-195:P02681:X04192
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  COAG_LIMPO/23-195
ASQ  PNVPTCLCEEPTLLGRKVIVSQETKDKIEEAVQAITDKDEISGRGFSIFGGHPAFKECGKYECRTVTSEDSRCYNFFPFHHFPSECPVSVSACEPTFGYTTSNELRIIVQAPKAGFRQCVWQHKCRAYGSNFCQRTGRCTQQRSVVRLVTYDLEKGVFFCENVRTCCGCPCRS-
DSQ  CCAAACGTCCCAACATGTCTTTGTGAAGAACCAACACTCCTGGGACGGAAAGTGATCGTGAGCCAAGAGACTAAAGATAAGATCGAGGAAGCTGTTCAAGCCATTACAGATAAAGACGAAATTTCAGGAAGAGGGTTTTCCATTTTTGGTGGCCATCCTGCGTTCAAGGAATGTGGCAAATACGAATGTCGAACTGTGACATCTGAAGATAGCCGTTGCTATAACTTTTTCCCGTTTCACCATTTCCCGAGCGAGTGTCCTGTTTCAGTTAGTGCTTGTGAGCCAACGTTTGGTTATACAACATCTAACGAGCTCAGAATAATTGTACAGGCTCCAAAGGCTGGGTTTAGACAGTGTGTGTGGCAACATAAGTGTCGTGCATATGGTAGTAACTTCTGTCAACGTACCGGGAGGTGCACCCAGCAGAGGTCAGTGGTTCGTTTGGTGACCTACGATTTGGAAAAGGGAGTTTTCTTTTGCGAAAACGTCAGAACATGCTGTGGTTGTCCTTGTAGATCT---
TRN  10010101100011001
NAM  COAG_TACTR/23-195
ASQ  TNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKLECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCR-FGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF
DSQ  ACAAACGCCCCAATATGTCTTTGTGACGAGCCAGGAGTTCTAGGACGGACTCAGATCGTGACGACGGAGATTAAAGATAAGATCGAGAAAGCTGTCGAAGCTGTTGCACAAGAGAGTGGTGTATCAGGAAGAGGATTTTCTATATTTTCTCATCATCCTGTGTTCAGGGAATGTGGCAAATACGAGTGTCGAACCGTGAGGCCTGAACACAGCCGTTGCTATAACTTTCCCCCGTTTATTCATTTCAAGTCAGAATGCCCTGTTTCAACTCGAGACTGTGAGCCAGTATTTGGTTATACGGTAGCAGGAGAGTTTAGGGTTATTGTACAGGCTCCAAGGGCTGGGTTTAGACAGTGTGTGTGGCAACATAAGTGTCGA---TTCGGTAGTAACAGCTGTGGTTATAATGGGAGGTGTACTCAGCAGAGGTCAGTGGTTCGTTTGGTGACCTACAACTTGGAGAAAGACGGTTTCTTGTGTGAAAGCTTCCGAACATGCTGTGGTTGTCCTTGTCGTAGTTTT
TRN  10010101110011001
//