EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02021 - UPF0102)
FAM  PF02021
PID  UPF0102
DES  Uncharacterised protein family UPF0102
IPR  IPR003509
ANO  8
ALN  99
AID  0.328326
APH  ((((Y189_SYNY3/7-103:0.47689,(Y823_HELPY/14-102:0.71426,Y041_AQUAE/5-89:0.44101):0.50526):0.06573,Y913_TREPA/11-104:0.57721):0.16913,(Y2922_MYCBO/15-109:0.31549,Y5602_STRCO/20-114:0.66739):0.28643):0.45281,YRAN_ECOLI/22-115:0.24204,Y1656_HAEIN/11-105:0.46268);
ATP  ((((Y189_SYNY3/7-103,(Y823_HELPY/14-102,Y041_AQUAE/5-89)),Y913_TREPA/11-104),(Y2922_MYCBO/15-109,Y5602_STRCO/20-114)),YRAN_ECOLI/22-115,Y1656_HAEIN/11-105);
ATL  5.41905
DNO  8
DLN  297
DID  0.427828
DPH  (YRAN_ECOLI/22-115:0.29252,((Y189_SYNY3/7-103:0.40804,(Y913_TREPA/11-104:0.40127,(Y5602_STRCO/20-114:0.31888,Y2922_MYCBO/15-109:0.31515):0.28833):0.11862):0.10520,(Y041_AQUAE/5-89:0.41893,Y823_HELPY/14-102:0.45660):0.28034):0.33974,Y1656_HAEIN/11-105:0.38726);
DTP  (YRAN_ECOLI/22-115,((Y189_SYNY3/7-103,(Y913_TREPA/11-104,(Y5602_STRCO/20-114,Y2922_MYCBO/15-109))),(Y041_AQUAE/5-89,Y823_HELPY/14-102)),Y1656_HAEIN/11-105);
DTL  4.13088
RID  0.328326
RPH  ((((Y189_SYNY3/7-103:0.47689,(Y823_HELPY/14-102:0.71426,Y041_AQUAE/5-89:0.44101):0.50526):0.06573,Y913_TREPA/11-104:0.57721):0.16913,(Y2922_MYCBO/15-109:0.31549,Y5602_STRCO/20-114:0.66739):0.28643):0.45281,YRAN_ECOLI/22-115:0.24204,Y1656_HAEIN/11-105:0.46268);
RTP  ((((Y189_SYNY3/7-103,(Y823_HELPY/14-102,Y041_AQUAE/5-89)),Y913_TREPA/11-104),(Y2922_MYCBO/15-109,Y5602_STRCO/20-114)),YRAN_ECOLI/22-115,Y1656_HAEIN/11-105);
RTL  5.41905
LNK  Y041_AQUAE/5-89:O66457:AE000671
LNK  Y1656_HAEIN/11-105:P45300:U32838
LNK  Y189_SYNY3/7-103:Q55761:D64002
LNK  Y2922_MYCBO/15-109:P67231:BX248344
LNK  Y5602_STRCO/20-114:O69890:AL939124
LNK  Y823_HELPY/14-102:O25499:AE000593
LNK  Y913_TREPA/11-104:O83883:AE001259
LNK  YRAN_ECOLI/22-115:P45465:U18997
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y1656_HAEIN/11-105
ASQ  SFEHQARLFLESKGLIFIAANQNF-KCGELDLIMND--KETIVFVEVRQRSHSAYGSA-IESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFG
DSQ  AGCTTTGAGCATCAAGCTCGTCTTTTTTTAGAATCAAAAGGCTTAATATTTATTGCGGCTAATCAAAATTTC---AAATGTGGTGAACTTGATCTAATAATGAATGAC------AAAGAAACTATCGTCTTTGTTGAAGTTCGCCAACGAAGTCATTCCGCCTATGGTTCTGCT---ATAGAAAGCGTAGATTGGCGAAAACAACAAAAATGGTTAGATGCCGCAAATTTATGGCTTGCAAAACAAAATATGAGCTTAGAAGATGCTAATTGCCGCTTTGATTTAATCGCTTTTGGC
TRN  10010101110011000
NAM  YRAN_ECOLI/22-115
ASQ  AWEAQARRWLEGKGLRFIAANVNE-RGGEIDLIMRE--GRTTIFVEVRYRRSALYGGA-AASVTRSKQHKLLQTARLWLARHNGSFDTVDCRFDVVAF-
DSQ  GCGTGGGAAGCACAAGCGCGTCGCTGGCTGGAAGGCAAAGGACTGCGGTTTATCGCCGCTAACGTGAACGAG---CGTGGCGGCGAGATCGATCTGATAATGCGTGAA------GGCCGGACCACCATTTTTGTCGAGGTACGCTATCGCCGCTCTGCGCTTTATGGCGGCGCG---GCAGCCAGTGTGACCCGCAGCAAACAACACAAATTATTACAGACTGCCCGCTTGTGGCTCGCGCGTCATAATGGGAGTTTTGATACTGTGGATTGCCGGTTCGATGTGGTAGCCTTC---
TRN  10010101100011010
NAM  Y189_SYNY3/7-103
ASQ  AGESLVAAWLEQQGGKILQQRWRS-PWGEIDLITHFPDTKIIAFVEVKTRSGGNWDQGGLLAVNARKQEKIWQTANHFLASQP-QWSDWNCRFDVMIVF
DSQ  GCCGGGGAAAGTTTGGTGGCGGCCTGGCTTGAACAGCAGGGCGGAAAAATCCTGCAACAACGCTGGCGATCG---CCGTGGGGAGAAATTGACTTAATTACCCATTTTCCGGACACCAAAATTATCGCCTTTGTGGAGGTAAAAACCCGTAGCGGCGGCAATTGGGACCAGGGGGGATTGTTGGCGGTCAACGCCCGTAAGCAGGAAAAAATCTGGCAAACAGCCAACCATTTCCTTGCTAGTCAGCCC---CAGTGGAGTGATTGGAACTGTCGTTTCGATGTGATGATCGTTTTT
TRN  11011101101011010
NAM  Y913_TREPA/11-104
ASQ  FGEAYAARWLATRGYIIITRNWRR-ATGEIDIIAQQ--DDTIVFVEVKTLRCTSYADL-AIIVGKRKQKRICETAKHFLASAR-EYNHMCARFDVIVLR
DSQ  TTTGGAGAGGCGTATGCGGCGCGCTGGCTAGCGACGCGCGGATATATTATCATCACACGAAACTGGCGCAGA---GCAACAGGTGAAATTGATATTATTGCGCAGCAG------GATGACACAATAGTATTCGTAGAAGTGAAGACGCTACGGTGTACCAGTTACGCCGACTTA---GCAATTATTGTTGGAAAGCGCAAGCAGAAAAGGATCTGTGAAACCGCTAAACATTTTCTTGCCAGCGCTCGA---GAATACAACCACATGTGTGCGCGCTTTGACGTCATCGTGCTGCGG
TRN  10010101100011010
NAM  Y5602_STRCO/20-114
ASQ  YGETLAARRLTGAGMTVLERNWRCGRTGEIDIVARD-GDVLVVC-EVKTRRGGAFEHP-MAAVTPDKAERLRRLAERWIQTHGG-APPGGVRIDLVGVL
DSQ  TACGGCGAGACACTCGCCGCCCGCCGGCTGACCGGAGCCGGCATGACCGTCCTGGAGCGCAACTGGCGCTGTGGCAGGACCGGCGAGATCGACATCGTGGCCCGGGAC---GGGGACGTCCTGGTCGTCTGC---GAGGTCAAGACGCGCCGGGGCGGCGCCTTCGAGCACCCG---ATGGCCGCCGTGACCCCGGACAAGGCGGAGCGGCTGCGGCGGCTCGCCGAGCGCTGGATCCAGACCCACGGAGGA---GCCCCGCCCGGCGGTGTCCGGATCGACCTGGTCGGCGTGCTC
TRN  10010101100011011
NAM  Y2922_MYCBO/15-109
ASQ  MGEALAVDYLTSMGLRILNRNWRC-RYGELDVIACDAATRTVVFVEVKTRTGDGYGGL-AHAVTERKVRRLRRLAGLWLADQE--ERWAAVRIDVIGVR
DSQ  ATGGGCGAGGCCCTAGCGGTGGACTACCTGACCAGCATGGGGTTGCGGATCTTGAACCGCAACTGGCGTTGC---CGCTACGGCGAGCTGGACGTGATCGCCTGCGACGCTGCCACCCGCACGGTGGTGTTCGTCGAGGTCAAGACCCGCACCGGCGACGGTTATGGGGGGCTC---GCGCACGCGGTGACCGAGCGCAAGGTTCGCCGCCTGCGTCGCCTGGCCGGGCTGTGGCTGGCCGACCAGGAA------GAGCGCTGGGCTGCGGTGCGCATCGATGTGATCGGCGTGCGA
TRN  11011111101111111
NAM  Y041_AQUAE/5-89
ASQ  EYEDLAARYLKSKGYQILGRNLRS-PYGEIDILAEF----EGRKVIVEVKGSETFFP--AEKVTPHKLSKIIRTAYEVLGEEP-------FSIEVVVVY
DSQ  GAGTACGAAGACTTAGCGGCTCGGTACTTAAAAAGTAAAGGTTATCAAATCCTCGGAAGAAACTTAAGAAGT---CCCTACGGTGAAATAGATATTCTGGCAGAGTTC------------GAGGGAAGGAAAGTTATCGTTGAAGTAAAGGGAAGTGAAACCTTCTTCCCG------GCGGAAAAGGTAACCCCTCATAAACTTAGCAAAATAATAAGAACCGCTTACGAAGTCCTCGGAGAAGAACCC---------------------TTTTCTATTGAGGTAGTGGTTGTCTAC
TRN  10010101100011010
NAM  Y823_HELPY/14-102
ASQ  KAEEEACGFLKSLGFEMVERNFFS-QFGEIDIIALK----KGVLHFIEVKSGENFDP--IYAITPSKLKKMIKTIRCYLSQKD--P-NSDFCIDALIVK
DSQ  AAGGCTGAAGAAGAAGCTTGCGGATTTTTAAAATCGTTAGGTTTTGAAATGGTGGAGAGGAACTTTTTTTCA---CAATTTGGCGAAATTGATATTATCGCTTTGAAA------------AAAGGGGTTTTGCATTTCATTGAAGTCAAAAGCGGGGAAAATTTTGATCCC------ATTTATGCGATCACGCCGAGCAAATTAAAAAAGATGATTAAAACGATCCGCTGTTATTTGTCCCAAAAAGAT------CCC---AATAGCGATTTTTGCATAGACGCTCTTATTGTGAAA
TRN  10010101110011000
//