EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01834 - XRCC1_N)
FAM  PF01834
PID  XRCC1_N
DES  XRCC1 N terminal domain
IPR  IPR002706
ANO  3
ALN  155
AID  0.952655
APH  (O54935_CRIGR/1-155:0.04741,XRCC1_MOUSE/1-153:0.01479,XRCC1_HUMAN/1-151:0.01344);
ATP  (O54935_CRIGR/1-155,XRCC1_MOUSE/1-153,XRCC1_HUMAN/1-151);
ATL  0.07564
DNO  3
DLN  465
DID  0.902499
DPH  (O54935_CRIGR/1-155:0.05092,XRCC1_MOUSE/1-153:0.03904,XRCC1_HUMAN/1-151:0.07108);
DTP  (O54935_CRIGR/1-155,XRCC1_MOUSE/1-153,XRCC1_HUMAN/1-151);
DTL  0.16104
RID  0.952655
RPH  (O54935_CRIGR/1-155:0.04741,XRCC1_MOUSE/1-153:0.01479,XRCC1_HUMAN/1-151:0.01344);
RTP  (O54935_CRIGR/1-155,XRCC1_MOUSE/1-153,XRCC1_HUMAN/1-151);
RTL  0.07564
LNK  O54935_CRIGR/1-155:O54935:AF034203
LNK  XRCC1_HUMAN/1-151:P18887:M36089
LNK  XRCC1_MOUSE/1-153:Q60596:U02887
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O54935_CRIGR/1-155
ASQ  MPEISLRHVVSGSSQDSTHCAENLLKADTYRKWRAATAGEKTISVVLQLEKEEQIHSIDIGNDGSAFVEVLVTRSAGGGGATAIEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPYGLSFVRFHS
DSQ  ATGCCGGAGATCAGCCTCCGCCACGTCGTGTCCGGCAGCAGCCAGGACTCGACCCATTGTGCAGAAAACCTTCTCAAGGCCGACACCTACCGGAAGTGGCGGGCAGCCACCGCAGGCGAGAAGACCATCTCTGTGGTCCTACAGTTGGAGAAGGAGGAGCAGATACACAGCATAGACATTGGGAATGATGGCTCGGCCTTCGTAGAGGTGCTGGTGACCCGGTCTGCCGGAGGGGGCGGGGCCACAGCCATCGAGCAGGACTATGAGGTCCTTCTGGTCACCTCCTCTTTCATGTCCCCTTCTGAGAGCCGAAGTGGCTCAAACCCCAACCGCGTTCGTATGTTTGGGCCTGACAAGTTAGTCCGGGCGGCAGCGGAGAAGCGCTGGGACCGTGTTAAAATTGTGTGCAGCCAGCCATACAGCAAGGACTCACCCTATGGCCTGAGTTTTGTGAGGTTTCACAGC
TRN  10010101100011000
NAM  XRCC1_MOUSE/1-153
ASQ  MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGA--TAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRIFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPYGLSFVKFHS
DSQ  ATGCCGGAGATCAGCCTCCGCCACGTCGTGTCCTGCAGCAGCCAGGACTCGACCCATTGTGCCGAAAATCTTCTCAAGGCGGACACTTACCGGAAGTGGCGGGCAGCCAAGGCAGGAGAGAAGACCATCTCTGTGGTCCTACAGTTGGAGAAGGAGGAGCAGATCCACAGTGTGGACATTGGCAATGATGGCTCGGCCTTTGTGGAGGTGCTAGTGGGCAGCTCGGCTGGAGGGGCC------ACAGCTGGAGAACAGGACTATGAGGTCCTTCTGGTCACCTCCTCTTTCATGTCCCCCTCTGAGAGCCGAAGTGGCTCAAATCCCAACCGTGTTCGCATTTTTGGACCTGACAAGTTAGTCCGGGCAGCAGCGGAGAAGCGCTGGGACCGTGTTAAAATTGTGTGCAGCCAGCCATACAGCAAGGACTCACCATACGGCCTGAGTTTTGTGAAGTTTCACAGC
TRN  11011101101011000
NAM  XRCC1_HUMAN/1-151
ASQ  MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGG----AGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS
DSQ  ATGCCGGAGATCCGCCTCCGCCATGTCGTGTCCTGCAGCAGCCAGGACTCGACTCACTGTGCAGAAAATCTTCTCAAGGCAGACACTTACCGAAAATGGCGGGCAGCCAAGGCAGGCGAGAAGACCATCTCTGTGGTCCTACAGTTGGAGAAGGAGGAGCAGATACACAGTGTGGACATTGGGAATGATGGCTCAGCTTTCGTGGAGGTGCTGGTGGGCAGTTCAGCTGGAGGC------------GCTGGGGAGCAAGACTATGAGGTCCTTCTGGTCACCTCATCTTTCATGTCCCCTTCCGAGAGCCGCAGTGGCTCAAACCCCAACCGCGTTCGCATGTTTGGGCCTGACAAGCTGGTCCGGGCAGCCGCCGAGAAGCGCTGGGACCGGGTCAAAATTGTTTGCAGCCAGCCCTACAGCAAGGACTCCCCCTTTGGCTTGAGTTTTGTACGGTTTCATAGC
TRN  10010101100011001
//