EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01819 - Levi_coat)
FAM  PF01819
PID  Levi_coat
DES  Levivirus coat protein
IPR  IPR002703
ANO  5
ALN  133
AID  0.326055
APH  (O64310_9VIRU/2-132:0.20925,COAT_BPQBE/1-132:0.07600,((COAT_BPF2/2-128:0.27638,COAT_BPGA/1-127:0.28850):0.80176,COAT_BPPRR/1-130:1.03326):0.97720);
ATP  (O64310_9VIRU/2-132,COAT_BPQBE/1-132,((COAT_BPF2/2-128,COAT_BPGA/1-127),COAT_BPPRR/1-130));
ATL  3.66235
DNO  3
DLN  399
DID  0.480341
DPH  (O64310_9VIRU/2-132:0.15717,COAT_BPQBE/1-132:0.26346,COAT_BPGA/1-127:1.12649);
DTP  (O64310_9VIRU/2-132,COAT_BPQBE/1-132,COAT_BPGA/1-127);
DTL  1.54712
RID  0.403118
RPH  (O64310_9VIRU/2-132:0.22304,COAT_BPQBE/1-132:0.06109,COAT_BPGA/1-127:2.09146);
RTP  (O64310_9VIRU/2-132,COAT_BPQBE/1-132,COAT_BPGA/1-127);
RTL  2.37559
LNK  COAT_BPF2/2-128:P03611:
LNK  COAT_BPGA/1-127:P07234:X03869
LNK  COAT_BPPRR/1-130:P03616:
LNK  COAT_BPQBE/1-132:P03615:M99039
LNK  O64310_9VIRU/2-132:O64310:AF059243
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O64310_9VIRU/2-132
ASQ  AKLNKVTLTGIGKAGNQTLTLTPRGVNPTNGVASLSEAGAVPALEKRVTVSVAQPSRNRKNYKVQIKLQNPTACTKD-ACDPSVTRSGSRDVTLSFTSYSTERER-ALIRTELAALLKDDLIVDAIDNLNPAY
DSQ  GCAAAATTGAATAAGGTTACGCTTACCGGTATTGGTAAGGCTGGAAATCAGACTTTAACTCTTACACCGCGTGGGGTAAACCCTACTAACGGCGTGGCGTCGCTATCTGAAGCTGGAGCTGTTCCGGCTTTGGAGAAGCGAGTAACTGTGTCAGTTGCTCAGCCATCTCGTAACCGTAAGAACTATAAAGTTCAGATTAAACTCCAGAACCCGACTGCATGCACGAAGGAC---GCATGCGACCCTTCTGTGACGCGTTCCGGTTCTCGCGACGTAACGCTGTCGTTCACGTCGTATTCAACCGAGCGTGAGCGC---GCGCTAATTCGCACTGAATTAGCGGCTCTGTTGAAGGATGATCTGATTGTCGATGCAATCGATAATCTGAATCCTGCATAC
TRN  11011101101011000
NAM  COAT_BPQBE/1-132
ASQ  AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEER-AFVRTELAALLASPLLIDAIDQLNPAY
DSQ  GCAAAATTAGAGACTGTTACTTTAGGTAACATCGGGAAAGATGGAAAACAAACTCTGGTCCTCAATCCGCGTGGGGTAAATCCCACTAACGGCGTTGCCTCGCTTTCACAAGCGGGTGCAGTTCCTGCGCTGGAGAAGCGTGTTACCGTTTCGGTATCTCAGCCTTCTCGCAATCGTAAGAACTACAAGGTCCAGGTTAAGATCCAGAACCCGACCGCTTGCACTGCAAACGGTTCTTGTGACCCATCCGTTACTCGCCAGGCATATGCTGACGTGACCTTTTCGTTCACGCAGTATAGTACCGATGAGGAACGA---GCTTTTGTTCGTACAGAGCTTGCTGCTCTGCTCGCTAGTCCTCTGCTGATCGATGCTATTGATCAGCTGAACCCAGCGTAT
TRN  11011101101011000
NAM  COAT_BPPRR/1-130
ASQ  AQLQNLVLKDREATPNDHTFVP---RDIRDNVGEVVESTGVPIGESRFTISLRKTSNGRYKSTLKLVVPVVQSQTVNGIVTPVVVRTSYVTVDFDYDARSTTKERNNFVGMIADALKADLMLVHDTIVNLQGV
NAM  COAT_BPGA/1-127
ASQ  ATLRSFVLVDNGGTGNVTVVP----VSNANGVAEWLSN-NSRSQAYRVTASYRASGADKRKYAIKLEVPKIVTQVVNGVELPGSAWKAYASIDLTIPIFAATDDV-TVISKSLAGLFKVGNPIAEAISSQSGF
DSQ  GCAACTTTACGCAGTTTCGTACTCGTCGATAATGGCGGTACGGGGAATGTTACTGTCGTTCCT------------GTTAGCAATGCCAACGGCGTCGCTGAGTGGCTTTCTAAT---AACTCGCGCAGTCAGGCTTATCGCGTGACTGCCAGTTATCGTGCGTCAGGCGCGGACAAGCGCAAATATGCCATTAAACTTGAAGTACCGAAAATCGTTACCCAAGTTGTAAATGGTGTTGAGCTGCCTGGTTCCGCATGGAAGGCTTATGCCTCTATCGACCTGACCATCCCTATCTTTGCTGCAACCGACGACGTG---ACTGTTATTTCCAAGTCGCTCGCCGGCCTGTTCAAAGTTGGGAACCCTATCGCTGAAGCTATCTCTTCACAGAGTGGCTTC
TRN  11011101101011000
NAM  COAT_BPF2/2-128
ASQ  SNFTQFVLVNDGGTGNVTVAP----SNFANGVAEWISS-NSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNLELTIPIFATNSDC-ELIVKAMQGLLKDGNPIPSAIAANSGI
//