EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01721 - Bacteriocin_II)
FAM  PF01721
PID  Bacteriocin_II
DES  Class II bacteriocin
IPR  IPR002633
ANO  11
ALN  36
AID  0.52346
APH  ((((((LCCC_LEUME/1-36:0.17346,(PPA1_PEDAC/19-54:0.21068,(MUTI_ENTMU/1-36:0.20620,SAKP_LACSK/19-54:0.08660):0.11832):0.19066):0.21055,(CBB2_CARPI/19-54:0.70365,LCCA_LEUGE/25-60:0.61429):0.19123):0.12043,Q47784_ENTFC/24-59:0.28542):0.26211,BAVM_LACSK/2-37:0.25225):0.39489,O30434_ENTFC/30-65:0.04702):0.09396,CBB1_CARPI/20-55:0.33175,SAKA_LACSK/20-55:0.14682);
ATP  ((((((LCCC_LEUME/1-36,(PPA1_PEDAC/19-54,(MUTI_ENTMU/1-36,SAKP_LACSK/19-54))),(CBB2_CARPI/19-54,LCCA_LEUGE/25-60)),Q47784_ENTFC/24-59),BAVM_LACSK/2-37),O30434_ENTFC/30-65),CBB1_CARPI/20-55,SAKA_LACSK/20-55);
ATL  4.68592
DNO  8
DLN  108
DID  0.549603
DPH  ((((CBB2_CARPI/19-54:0.40511,Q47784_ENTFC/24-59:0.36046):0.04445,((CBB1_CARPI/20-55:0.22775,O30434_ENTFC/30-65:0.11251):0.05610,SAKA_LACSK/20-55:0.19706):0.13959):0.15453,LCCA_LEUGE/25-60:0.38839):0.13968,PPA1_PEDAC/19-54:0.30500,SAKP_LACSK/19-54:0.19270);
DTP  ((((CBB2_CARPI/19-54,Q47784_ENTFC/24-59),((CBB1_CARPI/20-55,O30434_ENTFC/30-65),SAKA_LACSK/20-55)),LCCA_LEUGE/25-60),PPA1_PEDAC/19-54,SAKP_LACSK/19-54);
DTL  2.72333
RID  0.505144
RPH  ((Q47784_ENTFC/24-59:0.32875,((CBB2_CARPI/19-54:0.55034,LCCA_LEUGE/25-60:0.66923):0.19100,((CBB1_CARPI/20-55:0.34193,O30434_ENTFC/30-65:0.10627):0.11334,SAKA_LACSK/20-55:0.09662):0.29143):0.21938):0.37547,PPA1_PEDAC/19-54:0.12887,SAKP_LACSK/19-54:0.28738);
RTP  ((Q47784_ENTFC/24-59,((CBB2_CARPI/19-54,LCCA_LEUGE/25-60),((CBB1_CARPI/20-55,O30434_ENTFC/30-65),SAKA_LACSK/20-55))),PPA1_PEDAC/19-54,SAKP_LACSK/19-54);
RTL  3.8065
LNK  BAVM_LACSK/2-37:P80493:
LNK  CBB1_CARPI/20-55:P38579:L29058
LNK  CBB2_CARPI/19-54:P38580:L29059
LNK  LCCA_LEUGE/25-60:P34034:M64371
LNK  LCCC_LEUME/1-36:P81053:
LNK  MUTI_ENTMU/1-36:P80925:
LNK  O30434_ENTFC/30-65:O30434:AF005726
LNK  PPA1_PEDAC/19-54:P29430:M83924
LNK  Q47784_ENTFC/24-59:Q47784:X94181
LNK  SAKA_LACSK/20-55:P80097:Z14233
LNK  SAKP_LACSK/19-54:P35618:X75081
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SAKP_LACSK/19-54
ASQ  KYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWATG
DSQ  AAATATTATGGTAACGGTGTACACTGTGGAAAACATTCATGTACCGTAGACTGGGGAACAGCTATTGGAAATATCGGAAATAATGCAGCTGCAAACTGGGCCACAGGC
TRN  11111101111011001
NAM  MUTI_ENTMU/1-36
ASQ  KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATG
NAM  PPA1_PEDAC/19-54
ASQ  KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATG
DSQ  AAATACTACGGTAATGGGGTTACTTGTGGCAAACATTCCTGCTCTGTTGACTGGGGTAAGGCTACCACTTGCATAATCAATAATGGAGCTATGGCATGGGCTACTGGT
TRN  10010101110011011
NAM  LCCC_LEUME/1-36
ASQ  KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTG
NAM  Q47784_ENTFC/24-59
ASQ  KYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGG
DSQ  AAATATTATGGAAATGGAGTGTATTGCACTAAAAATAAATGTACGGTCGATTGGGCCAAGGCAACTACTTGTATTGCAGGAATGTCTATAGGTGGTTTTTTAGGTGGA
TRN  10010101110011010
NAM  BAVM_LACSK/2-37
ASQ  KYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGG
NAM  LCCA_LEUGE/25-60
ASQ  KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGF
DSQ  AAGTATTATGGTAACGGAGTTCATTGCACAAAAAGTGGTTGTTCTGTAAACTGGGGAGAAGCCTTTTCAGCTGGAGTACATCGTTTAGCAAATGGTGGAAATGGTTTC
TRN  11111101111011000
NAM  SAKA_LACSK/20-55
ASQ  RSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASG
DSQ  AGATCATATGGCAACGGTGTTTACTGTAATAATAAAAAATGTTGGGTAAATCGGGGTGAAGCAACGCAAAGTATTATTGGTGGTATGATTAGCGGCTGGGCTAGTGGT
TRN  10110101110011001
NAM  O30434_ENTFC/30-65
ASQ  RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASG
DSQ  CGTTCATATGGTAATGGTGTTTATTGTAATAATAGTAAATGCTGGGTTAACTGGGGAGAAGCTAAAGAGAATATTGCAGGAATCGTTATTAGTGGCTGGGCTTCTGGT
TRN  11111101111011001
NAM  CBB1_CARPI/20-55
ASQ  ISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASS
DSQ  ATCTCTTATGGCAATGGTGTTTATTGTAACAAAGAGAAATGTTGGGTAAACAAGGCAGAAAACAAACAAGCTATTACTGGAATAGTTATCGGTGGATGGGCTTCTAGT
TRN  10010101110011011
NAM  CBB2_CARPI/19-54
ASQ  VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSG
DSQ  GTAAATTATGGTAATGGTGTTTCTTGCAGTAAAACAAAATGTTCAGTTAACTGGGGACAAGCCTTTCAAGAAAGATACACAGCTGGAATTAACTCATTTGTAAGTGGA
TRN  10110101110011001
//