EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01599 - Ribosomal_S27)
FAM  PF01599
PID  Ribosomal_S27
DES  Ribosomal protein S27a
IPR  IPR002906
ANO  13
ALN  47
AID  0.580946
APH  (((RS27A_SOLTU/25-71:0.20621,RS27A_HUMAN/25-71:0.10359):0.05037,(((RS27A_METTH/2-45:0.50664,RS27A_ARCFU/7-50:0.16536):0.17562,RS27A_METJA/8-51:0.15629):0.15699,RS27A_HALMA/1-40:0.57095):0.49541):0.04476,(((RS37_YEAST/25-71:0.21905,O60036_CANAL/101-147:0.14280):0.06203,O14257_SCHPO/101-145:0.16462):0.06688,RS27A_NEUCR/25-71:0.12610):0.06779,((RS27A_CAEBR/25-71:0.20457,RS27A_DICDI/26-72:0.11443):0.05973,RS27A_MANSE/25-71:0.20852):0.06588);
ATP  (((RS27A_SOLTU/25-71,RS27A_HUMAN/25-71),(((RS27A_METTH/2-45,RS27A_ARCFU/7-50),RS27A_METJA/8-51),RS27A_HALMA/1-40)),(((RS37_YEAST/25-71,O60036_CANAL/101-147),O14257_SCHPO/101-145),RS27A_NEUCR/25-71),((RS27A_CAEBR/25-71,RS27A_DICDI/26-72),RS27A_MANSE/25-71));
ATL  4.13459
DNO  6
DLN  141
DID  0.558962
DPH  (RS27A_METTH/2-45:0.37599,((RS27A_HALMA/1-40:0.34649,(O14257_SCHPO/101-145:0.26163,O60036_CANAL/101-147:0.20953):0.26292):0.06698,RS27A_METJA/8-51:0.24109):0.07723,RS27A_ARCFU/7-50:0.16334);
DTP  (RS27A_METTH/2-45,((RS27A_HALMA/1-40,(O14257_SCHPO/101-145,O60036_CANAL/101-147)),RS27A_METJA/8-51),RS27A_ARCFU/7-50);
DTL  2.0052
RID  0.526211
RPH  ((RS27A_METTH/2-45:0.51366,RS27A_ARCFU/7-50:0.14122):0.15643,RS27A_METJA/8-51:0.18075,((O60036_CANAL/101-147:0.13153,O14257_SCHPO/101-145:0.17660):0.44123,RS27A_HALMA/1-40:0.48569):0.18877);
RTP  ((RS27A_METTH/2-45,RS27A_ARCFU/7-50),RS27A_METJA/8-51,((O60036_CANAL/101-147,O14257_SCHPO/101-145),RS27A_HALMA/1-40));
RTL  2.41588
LNK  O14257_SCHPO/101-145:O14257:Z98603
LNK  O60036_CANAL/101-147:O60036:Y15608
LNK  RS27A_ARCFU/7-50:O29152:AE001027
LNK  RS27A_CAEBR/25-71:P37164:
LNK  RS27A_DICDI/26-72:P14797:
LNK  RS27A_HALMA/1-40:Q06125:X70117
LNK  RS27A_HUMAN/25-71:P62979:
LNK  RS27A_MANSE/25-71:P29504:
LNK  RS27A_METJA/8-51:P54031:U67492
LNK  RS27A_METTH/2-45:O26368:AE000812
LNK  RS27A_NEUCR/25-71:P14799:
LNK  RS27A_SOLTU/25-71:P62981:
LNK  RS37_YEAST/25-71:P05759:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RS27A_ARCFU/7-50
ASQ  SIYRYYEIKGEK-VVRKKKFCPR--CGEGVFLAEHKDRLSCGKCGYT
DSQ  AGCATTTACAGATACTACGAGATAAAGGGCGAGAAA---GTCGTAAGAAAGAAGAAATTCTGTCCGAGA------TGTGGTGAGGGAGTCTTCTTAGCTGAGCACAAGGACAGGCTAAGCTGCGGCAAGTGCGGCTACACT
TRN  10010101110011010
NAM  RS27A_METJA/8-51
ASQ  AKYKYYKIEGDK-VIRLKKTCPR--CGPGVFMAEHLNRYACGKCGYM
DSQ  GCAAAATACAAATACTACAAGATTGAAGGAGATAAA---GTTATTAGATTGAAGAAGACCTGTCCAAGA------TGTGGTCCTGGAGTTTTCATGGCTGAGCACTTAAACAGATACGCATGTGGAAAATGTGGCTACATG
TRN  10110101110011010
NAM  RS27A_HALMA/1-40
ASQ  PHNEYYNDDGE--LDR--ETCPR--CGD-TVLAEHEDRQHCGKCGYT
DSQ  CCACACAACGAGTACTACAACGACGATGGCGAA------CTCGACCGC------GAGACCTGCCCCCGG------TGCGGTGAC---ACCGTCCTCGCCGAGCACGAGGACCGCCAGCACTGCGGGAAGTGCGGCTACACC
TRN  11011111111111111
NAM  RS27A_METTH/2-45
ASQ  KKFELYEVKDGK-LVRKNPFCVR--CSNGVFMADHGDRYACGKCGYT
DSQ  AAGAAATTTGAGCTCTACGAGGTCAAGGACGGTAAA---CTCGTCAGGAAGAACCCCTTCTGTGTCAGG------TGCTCAAACGGTGTCTTCATGGCAGACCATGGGGACAGGTACGCCTGCGGTAAATGCGGATACACC
TRN  10010101110011001
NAM  O14257_SCHPO/101-145
ASQ  AVLKYYKVEDDGSVKRLRRECPN--CGASTFMANHKDRLYCGRCHLT
DSQ  GCCGTCCTCAAATACTACAAGGTTGAGGATGATGGAAGCGTTAAGCGTCTTCGTCGTGAGTGTCCCAAC------TGTGGTGCGTCCACCTTCATGGCCAACCACAAGGACCGCCTTTACTGTGGTAGATGCCATTTGACT
TRN  10010101110011011
NAM  RS27A_NEUCR/25-71
ASQ  AVLKYYKVDSDGKIDRLRRECPNETCGAGVFMAAMQDRQYCGRCHLT
NAM  O60036_CANAL/101-147
ASQ  AVLTYYKVDNEGNVERLRRECPAPTCGAGIFMANMKDRQYCGKCHLT
DSQ  GCTGTTTTGACTTACTACAAAGTTGACAACGAAGGTAACGTCGAAAGATTGAGAAGAGAATGTCCAGCTCCAACTTGTGGTGCCGGTATTTTCATGGCCAACATGAAAGACAGACAATACTGTGGTAAATGTCACTTGACC
TRN  10110101110011011
NAM  RS27A_MANSE/25-71
ASQ  AVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST
NAM  RS27A_HUMAN/25-71
ASQ  AVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT
NAM  RS27A_SOLTU/25-71
ASQ  AVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLT
NAM  RS37_YEAST/25-71
ASQ  AVLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSV
NAM  RS27A_DICDI/26-72
ASQ  AVLKYYKFDENGKIKRVLRECPAETCGAGVFMAQHANRQYCGKCHST
NAM  RS27A_CAEBR/25-71
ASQ  AVLKYYKVDENGKITRLRKECQQPSCGGGVFMAQHANRHYCGRCHDT
//