EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01396 - zf-C4_Topoisom)
FAM  PF01396
PID  zf-C4_Topoisom
DES  Topoisomerase DNA binding C4 zinc finger
IPR  IPR000380
ANO  27
ALN  43
AID  0.392746
APH  ((((((((((TOP1_BACAN/602-634:0.56534,(Q60149_STRPY/630-664:0.00000,Q43888_STRAG/238-272:0.00000):0.26930):0.15896,(TOP1_METTH/595-635:0.66077,(TOP1_ARCFU/580-619:0.43537,TOP1_METJA/597-635:0.28546):0.19186):0.16661):0.17611,(TP3A_HUMAN/655-694:0.95817,TOP1_METTH/677-715:0.45784):0.17853):0.15374,TOP1_METJA/718-756:0.23260):0.26398,((((TOP1_MYCGE/615-655:0.11814,TOP1_MYCPN/621-661:0.20114):0.42330,Y664_METJA/263-301:0.66917):0.16359,(TOP1_MYCGE/664-705:0.12397,TOP1_MYCPN/670-711:0.07689):0.53532):0.21016,((YRDD_ECOLI/61-99:0.32189,(YRDD_HAEIN/12-50:0.56892,YRDD_HAEIN/59-97:0.38375):0.23640):0.13230,TOP1_METJA/677-715:0.29063):0.08993):0.14661):0.20646,((TOP1_BACSU/616-656:0.42190,TOP1_HELPY/660-698:0.27191):0.27647,(YRDD_ECOLI/103-143:0.16479,YRDD_HAEIN/101-141:0.51600):0.22001):0.51843):0.09216,TOP1_HELPY/569-607:0.35546):0.21655,TOP1_HELPY/613-651:0.19685):0.27314,TOP1_BACSU/576-614:0.31656):0.46179,TOP1_ECOLI/708-745:0.00000,TOP1_HAEIN/713-748:0.24256);
ATP  ((((((((((TOP1_BACAN/602-634,(Q60149_STRPY/630-664,Q43888_STRAG/238-272)),(TOP1_METTH/595-635,(TOP1_ARCFU/580-619,TOP1_METJA/597-635))),(TP3A_HUMAN/655-694,TOP1_METTH/677-715)),TOP1_METJA/718-756),((((TOP1_MYCGE/615-655,TOP1_MYCPN/621-661),Y664_METJA/263-301),(TOP1_MYCGE/664-705,TOP1_MYCPN/670-711)),((YRDD_ECOLI/61-99,(YRDD_HAEIN/12-50,YRDD_HAEIN/59-97)),TOP1_METJA/677-715))),((TOP1_BACSU/616-656,TOP1_HELPY/660-698),(YRDD_ECOLI/103-143,YRDD_HAEIN/101-141))),TOP1_HELPY/569-607),TOP1_HELPY/613-651),TOP1_BACSU/576-614),TOP1_ECOLI/708-745,TOP1_HAEIN/713-748);
ATL  14.8088
DNO  27
DLN  129
DID  0.469592
DPH  (((((((((TOP1_MYCGE/615-655:0.04324,TOP1_MYCPN/621-661:0.32488):0.27251,(TOP1_MYCGE/664-705:0.21415,TOP1_MYCPN/670-711:0.07152):0.29504):0.21907,(TP3A_HUMAN/655-694:0.73738,TOP1_METTH/677-715:0.18026):0.30644):0.07293,((TOP1_BACSU/616-656:0.41175,TOP1_HELPY/660-698:0.20218):0.32018,(YRDD_ECOLI/103-143:0.36341,YRDD_HAEIN/101-141:0.30591):0.02776):0.20495):0.15951,(YRDD_ECOLI/61-99:0.28542,(((((((TOP1_METTH/595-635:0.44398,TOP1_ARCFU/580-619:0.25208):0.22823,TOP1_METJA/597-635:0.18467):0.15797,(Q60149_STRPY/630-664:0.03995,Q43888_STRAG/238-272:0.00000):0.23512):0.12336,TOP1_BACAN/602-634:0.42531):0.07840,TOP1_METJA/718-756:0.18770):0.08499,(Y664_METJA/263-301:0.44659,TOP1_METJA/677-715:0.10319):0.14656):0.18489,(YRDD_HAEIN/12-50:0.36323,YRDD_HAEIN/59-97:0.29763):0.15274):0.06855):0.12517):0.11796,TOP1_HELPY/569-607:0.18695):0.13697,TOP1_HELPY/613-651:0.13133):0.24043,TOP1_BACSU/576-614:0.26692):0.32051,TOP1_ECOLI/708-745:0.09738,TOP1_HAEIN/713-748:0.26742);
DTP  (((((((((TOP1_MYCGE/615-655,TOP1_MYCPN/621-661),(TOP1_MYCGE/664-705,TOP1_MYCPN/670-711)),(TP3A_HUMAN/655-694,TOP1_METTH/677-715)),((TOP1_BACSU/616-656,TOP1_HELPY/660-698),(YRDD_ECOLI/103-143,YRDD_HAEIN/101-141))),(YRDD_ECOLI/61-99,(((((((TOP1_METTH/595-635,TOP1_ARCFU/580-619),TOP1_METJA/597-635),(Q60149_STRPY/630-664,Q43888_STRAG/238-272)),TOP1_BACAN/602-634),TOP1_METJA/718-756),(Y664_METJA/263-301,TOP1_METJA/677-715)),(YRDD_HAEIN/12-50,YRDD_HAEIN/59-97)))),TOP1_HELPY/569-607),TOP1_HELPY/613-651),TOP1_BACSU/576-614),TOP1_ECOLI/708-745,TOP1_HAEIN/713-748);
DTL  10.9544
RID  0.392746
RPH  ((((((((((TOP1_BACAN/602-634:0.56534,(Q60149_STRPY/630-664:0.00000,Q43888_STRAG/238-272:0.00000):0.26930):0.15896,(TOP1_METTH/595-635:0.66077,(TOP1_ARCFU/580-619:0.43537,TOP1_METJA/597-635:0.28546):0.19186):0.16661):0.17611,(TP3A_HUMAN/655-694:0.95817,TOP1_METTH/677-715:0.45784):0.17853):0.15374,TOP1_METJA/718-756:0.23260):0.26398,((((TOP1_MYCGE/615-655:0.11814,TOP1_MYCPN/621-661:0.20114):0.42330,Y664_METJA/263-301:0.66917):0.16359,(TOP1_MYCGE/664-705:0.12397,TOP1_MYCPN/670-711:0.07689):0.53532):0.21016,((YRDD_ECOLI/61-99:0.32189,(YRDD_HAEIN/12-50:0.56892,YRDD_HAEIN/59-97:0.38375):0.23640):0.13230,TOP1_METJA/677-715:0.29063):0.08993):0.14661):0.20646,((TOP1_BACSU/616-656:0.42190,TOP1_HELPY/660-698:0.27191):0.27647,(YRDD_ECOLI/103-143:0.16479,YRDD_HAEIN/101-141:0.51600):0.22001):0.51843):0.09216,TOP1_HELPY/569-607:0.35546):0.21655,TOP1_HELPY/613-651:0.19685):0.27314,TOP1_BACSU/576-614:0.31656):0.46179,TOP1_ECOLI/708-745:0.00000,TOP1_HAEIN/713-748:0.24256);
RTP  ((((((((((TOP1_BACAN/602-634,(Q60149_STRPY/630-664,Q43888_STRAG/238-272)),(TOP1_METTH/595-635,(TOP1_ARCFU/580-619,TOP1_METJA/597-635))),(TP3A_HUMAN/655-694,TOP1_METTH/677-715)),TOP1_METJA/718-756),((((TOP1_MYCGE/615-655,TOP1_MYCPN/621-661),Y664_METJA/263-301),(TOP1_MYCGE/664-705,TOP1_MYCPN/670-711)),((YRDD_ECOLI/61-99,(YRDD_HAEIN/12-50,YRDD_HAEIN/59-97)),TOP1_METJA/677-715))),((TOP1_BACSU/616-656,TOP1_HELPY/660-698),(YRDD_ECOLI/103-143,YRDD_HAEIN/101-141))),TOP1_HELPY/569-607),TOP1_HELPY/613-651),TOP1_BACSU/576-614),TOP1_ECOLI/708-745,TOP1_HAEIN/713-748);
RTL  14.8088
LNK  Q43888_STRAG/238-272:Q43888:X72021
LNK  Q60149_STRPY/630-664:Q60149:X64695
LNK  TOP1_ARCFU/580-619:O28469:AE000978
LNK  TOP1_BACAN/602-634:P40114:AE011190
LNK  TOP1_BACSU/576-614:P39814:L27797
LNK  TOP1_BACSU/616-656:P39814:L27797
LNK  TOP1_ECOLI/708-745:P06612:X04475
LNK  TOP1_HAEIN/713-748:P43012:U20964
LNK  TOP1_HELPY/569-607:P55991:AE000533
LNK  TOP1_HELPY/613-651:P55991:AE000533
LNK  TOP1_HELPY/660-698:P55991:AE000533
LNK  TOP1_METJA/597-635:Q59046:U67605
LNK  TOP1_METJA/677-715:Q59046:U67605
LNK  TOP1_METJA/718-756:Q59046:U67605
LNK  TOP1_METTH/595-635:O27661:AE000921
LNK  TOP1_METTH/677-715:O27661:AE000921
LNK  TOP1_MYCGE/615-655:P47368:U39692
LNK  TOP1_MYCGE/664-705:P47368:U39692
LNK  TOP1_MYCPN/621-661:P78032:AE000056
LNK  TOP1_MYCPN/670-711:P78032:AE000056
LNK  TP3A_HUMAN/655-694:Q13472:U43431
LNK  Y664_METJA/263-301:Q58078:U67513
LNK  YRDD_ECOLI/103-143:P45771:U00096
LNK  YRDD_ECOLI/61-99:P45771:U00096
LNK  YRDD_HAEIN/101-141:P46494:U32748
LNK  YRDD_HAEIN/12-50:P46494:U32748
LNK  YRDD_HAEIN/59-97:P46494:U32748
AMK  xxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YRDD_HAEIN/101-141
ASQ  KITCPECKTGHLISRRGRQG.-KIFYGCDNFPKCKFSLPAKPY
DSQ  AAAATTACTTGTCCTGAATGTAAAACGGGACATTTGATTTCTCGTCGAGGTCGCCAAGGA...---AAGATTTTTTACGGCTGTGATAATTTCCCTAAATGTAAATTTTCTTTGCCTGCCAAGCCTTAT
TRN  11111101111011011
NAM  YRDD_ECOLI/103-143
ASQ  AITCPQCRTGHLVQRRSRYG.-KTFHSCDRYPECQFAINFKPI
DSQ  GCAATTACATGCCCCCAATGTCGGACGGGCCATCTGGTCCAGCGCCGCTCCCGTTATGGC...---AAAACATTTCACTCTTGTGATCGCTACCCGGAGTGTCAATTTGCCATTAACTTCAAACCCATA
TRN  10010101100011011
NAM  TOP1_HELPY/660-698
ASQ  GVKCPECG-GDIALKRSKKG.--SFYGCNNYPKCNFLSNHKPI
DSQ  GGCGTGAAATGCCCAGAATGCGGA---GGGGATATTGCTTTAAAAAGGAGTAAGAAAGGC...------TCGTTTTATGGCTGTAACAATTACCCTAAATGCAATTTTTTATCCAACCATAAGCCCATC
TRN  10110101110011010
NAM  TOP1_BACSU/616-656
ASQ  GVKCPSCGEGNIVERKSKKK.-RVFYGCDRYPDCEFVSWDKPI
DSQ  GGTGTGAAGTGCCCGAGCTGCGGAGAAGGAAACATTGTTGAGCGAAAATCGAAAAAGAAA...---CGGGTGTTTTACGGCTGTGACCGTTATCCGGACTGTGAATTCGTATCATGGGACAAACCAATT
TRN  11111101111011001
NAM  YRDD_HAEIN/59-97
ASQ  DEICPKCG-NLLQLKQGSFG.--MFIGCSHYPECDFVVREESE
DSQ  GATGAAATTTGCCCGAAGTGCGGT---AATTTATTGCAGTTGAAACAAGGCAGTTTTGGG...------ATGTTTATTGGTTGTAGTCATTATCCTGAATGCGATTTTGTGGTGCGGGAAGAATCTGAA
TRN  11111101111011010
NAM  YRDD_HAEIN/12-50
ASQ  QEYCPQCG-APLQIKQGKKG.--LFLGCSAYPECDYLRPLQRS
DSQ  CAGGAATATTGCCCTCAATGTGGT---GCGCCGTTGCAAATTAAACAAGGCAAAAAAGGG...------CTGTTTCTAGGTTGCTCTGCTTATCCTGAATGTGATTATTTGCGTCCTTTGCAACGATCG
TRN  11011101101011011
NAM  TOP1_METJA/718-756
ASQ  VGKCPKCG-GDLVVREGKFG.--KFVGCSNYPKCRYTEKLKLN
DSQ  GTAGGAAAATGCCCTAAATGTGGA---GGAGATTTAGTTGTTAGAGAAGGTAAGTTTGGA...------AAGTTTGTTGGTTGCTCTAACTATCCAAAGTGTAGATATACTGAAAAACTAAAACTAAAT
TRN  10010101110011010
NAM  TOP1_METTH/677-715
ASQ  VGKCPECG-SDLIKRSGRYG.--EFVGCKGFPKCRFTCSVDEV
DSQ  GTCGGTAAATGCCCTGAATGTGGT---TCAGACCTCATAAAGCGCTCCGGACGTTACGGG...------GAATTCGTCGGTTGTAAGGGATTCCCGAAGTGTCGCTTCACCTGTTCCGTTGATGAGGTC
TRN  10010101110011001
NAM  TOP1_METJA/677-715
ASQ  DRICPKCG-AKLILKKGVYG.--AFYGCSNYPKCKYTEPINKK
DSQ  GATAGGATTTGCCCAAAGTGCGGA---GCTAAGCTAATTTTAAAGAAAGGAGTTTATGGA...------GCATTTTATGGTTGTTCAAACTATCCAAAGTGTAAATATACAGAACCAATAAATAAAAAA
TRN  10010101110011000
NAM  Q43888_STRAG/238-272
ASQ  VGKCPKCG-NNIVLKKS---.---FYGCSNYPECKFTLAEHFR
DSQ  GTAGGAAAATGTCCTAAGTGTGGC---AACAATATTGTATTAAAAAAATCG---------...---------TTTTATGGTTGTTCAAATTATCCTGAATGTAAGTTTACTTTAGCTGAACATTTTAGA
TRN  10110101110011000
NAM  Q60149_STRPY/630-664
ASQ  VGKCPKCG-NNIVLKKS---.---FYGCSNYPECKFTLAEHFR
DSQ  GTAGGCAAATGTCCTAAGTGCGGC---AATAATATTGTATTAAAAAAATCG---------...---------TTTTATGGTTGTTCAAATTATCCTGAATGTAAGTTCACTTTAGCTGAACATTTTAGA
TRN  10110101110011000
NAM  YRDD_ECOLI/61-99
ASQ  GQVCPACG-ANLVLRQGRFG.--MFIGCINYPECEHTELIDKP
DSQ  GGGCAGGTTTGCCCTGCATGTGGC---GCAAATCTGGTATTACGCCAGGGACGCTTTGGT...------ATGTTTATTGGTTGCATTAACTACCCTGAATGCGAACATACCGAACTTATCGATAAACCG
TRN  11011101101011010
NAM  TOP1_BACAN/602-634
ASQ  VCQCP-CG-NGIILDRG---.--KFFGCSNHPNCN--KGLPKR
DSQ  GTATGCCAATGCCCT---TGTGGA---AATGGAATAATCTTAGATAGAGGA---------...------AAGTTTTTCGGGTGTAGCAATCACCCGAACTGTAAC------AAGGGATTACCCAAAAGA
TRN  10010101110011010
NAM  TOP1_METJA/597-635
ASQ  VGKCPKCGGDLILIRHKKG-.--RFVGCSNYPECDVKYSLPDK
DSQ  GTTGGAAAATGTCCTAAATGTGGAGGAGACTTAATTTTAATAAGACATAAAAAGGGC---...------AGGTTTGTTGGCTGCTCTAACTATCCTGAATGTGATGTAAAATACTCCTTACCAGATAAA
TRN  10010101110011010
NAM  TOP1_ARCFU/580-619
ASQ  VGKCPECGGELVVRQSKAGK.--RFIGCSNYPDCTFTLPLPQN
DSQ  GTTGGAAAATGTCCAGAATGTGGTGGAGAGCTTGTGGTGAGACAGTCCAAGGCCGGTAAG...------AGGTTCATAGGTTGCAGCAACTATCCTGACTGCACCTTCACCCTTCCACTTCCCCAGAAT
TRN  10010101110011011
NAM  TOP1_METTH/595-635
ASQ  VGECPACG-GKLVIKYSPRN.RSTFVGCSSYPDCRTVYSLPRG
DSQ  GTGGGTGAATGCCCCGCCTGTGGT---GGGAAGCTCGTCATAAAATACTCTCCCAGAAAC...AGGAGCACCTTTGTGGGGTGTTCCAGCTACCCTGACTGCAGGACCGTTTACTCACTTCCAAGGGGC
TRN  10010101110011001
NAM  Y664_METJA/263-301
ASQ  DNTCPWCG-AKLRVVRTKKG.--EFLGCTNYPNCLYRRFPKKN
DSQ  GATAACACTTGCCCATGGTGTGGA---GCTAAGTTGAGAGTAGTTAGAACAAAAAAAGGA...------GAGTTCTTGGGATGCACAAATTATCCAAACTGTCTATATAGAAGATTTCCAAAGAAAAAT
TRN  10010101110011011
NAM  TOP1_MYCPN/670-711
ASQ  EELCPECN-SQLVKRRTKFNpNKTFVGCSNFPRCRYIKKDNAS
DSQ  GAAGAACTGTGTCCGGAGTGTAAC---AGCCAACTAGTGAAAAGACGCACTAAGTTTAATcccAATAAAACCTTTGTTGGTTGTAGTAATTTCCCTAGGTGCCGCTACATAAAGAAGGATAATGCTAGC
TRN  10010101100011011
NAM  TOP1_MYCGE/664-705
ASQ  DELCPECN-NKLVKRRTKFNaKKTFIGCSNFPNCRFIKKDNAA
DSQ  GATGAATTGTGTCCTGAGTGTAAC---AATAAACTGGTTAAGAGGAGAACTAAATTTAACgctAAAAAGACCTTTATAGGTTGCAGTAATTTCCCTAACTGCCGTTTTATCAAAAAGGATAATGCTGCT
TRN  10010101100011011
NAM  TOP1_MYCPN/621-661
ASQ  GRDCPSCA-SPLLYRYTKRG.NEKFVGCSNFPNCKYNEFSQNK
DSQ  GGTCGTGATTGTCCAAGCTGTGCT---AGTCCCTTGTTGTACCGCTATACTAAACGGGGT...AATGAAAAGTTTGTTGGGTGCAGTAACTTTCCCAACTGTAAATACAACGAGTTTAGCCAAAATAAA
TRN  11111101111011011
NAM  TOP1_MYCGE/615-655
ASQ  ERDCPKCN-QPLVYRYTKRG.NEKFVGCSDFPKCKYSEFSNPK
DSQ  GAAAGAGATTGTCCTAAATGTAAT---CAACCGTTGGTATATCGTTACACCAAAAGAGGT...AATGAGAAGTTTGTTGGTTGTAGTGATTTTCCTAAGTGTAAATACAGTGAGTTTAGTAATCCTAAA
TRN  10110101110011011
NAM  TOP1_HELPY/613-651
ASQ  QELCEKCG-GEMVQKFSRNG.--AFLACNNYPECKNTKSLKNT
DSQ  CAAGAATTGTGCGAAAAATGCGGA---GGGGAAATGGTGCAAAAATTCAGCAGAAACGGG...------GCGTTTTTAGCTTGCAACAATTACCCTGAATGCAAAAACACCAAATCGTTAAAAAACACC
TRN  10110101110011010
NAM  TOP1_HELPY/569-607
ASQ  GQSCPKCG-GELVKKNSRYG.--EFIACNNYPKCKYVKQTESA
DSQ  GGTCAATCATGCCCTAAATGCGGT---GGGGAATTAGTCAAAAAAAATAGCCGTTATGGG...------GAGTTTATCGCTTGCAACAATTACCCTAAATGCAAATATGTCAAACAAACTGAAAGCGCT
TRN  11111101111011000
NAM  TOP1_HAEIN/713-748
ASQ  VVECDKCG-ADMHLKLGRFG.--KYMGCTN---CDNTRKILKN
DSQ  GTTGTTGAGTGTGATAAATGCGGT---GCGGATATGCATCTAAAACTTGGTCGTTTTGGC...------AAGTATATGGGATGTACAAAT---------TGTGATAACACACGCAAAATTTTGAAAAAT
TRN  11011101111011011
NAM  TOP1_ECOLI/708-745
ASQ  IVECEKCG-SEMHLKMGRFG.--KYMACTNE-ECKNTRKILRN
DSQ  ATCGTTGAGTGTGAAAAATGTGGC---TCTGAAATGCACCTGAAAATGGGGCGTTTCGGT...------AAATACATGGCCTGCACCAACGAA---GAGTGTAAAAACACACGTAAGATTTTACGTAAC
TRN  11011101101011010
NAM  TOP1_BACSU/576-614
ASQ  GEDCELCS-SPMVYKMGRYG.--KFLACSNFPDCRNTKPIVKQ
DSQ  GGAGAGGATTGTGAATTGTGCAGT---TCTCCAATGGTATATAAAATGGGACGGTACGGT...------AAATTCTTAGCTTGCTCCAACTTCCCTGACTGCCGGAACACGAAACCGATTGTGAAACAA
TRN  11111101111011010
NAM  TP3A_HUMAN/655-694
ASQ  IRKCPQCN-KDMVLKTKKNG.-GFYLSCMGFPECRSAVWLPDS
DSQ  ATCAGGAAGTGCCCACAGTGCAAC---AAGGACATGGTCCTTAAGACCAAGAAGAATGGC...---GGGTTCTACCTCAGCTGCATGGGTTTCCCAGAGTGTCGCTCAGCTGTGTGGCTTCCTGACTCG
TRN  10010101110011001
//