EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01394 - Clathrin_propel)
FAM  PF01394
PID  Clathrin_propel
DES  Clathrin propeller repeat
IPR  IPR001473
ANO  71
ALN  44
AID  0.155812
APH  ((((((((((CLH_CAEEL/17-54:0.35139,Q9CA00_ARATH/20-56:0.18927):0.13085,(CLH_RAT/19-56:0.10753,CLH_DROME/19-56:0.14821):0.11758):0.06558,CLH_DICDI/18-56:0.21921):0.25503,Q95Z06_9TRYP/19-57:0.45824):0.02523,(CLH_YEAST/18-55:0.71826,CLH_SCHPO/19-56:0.27939):0.02023):0.06641,Q7SHV2_NEUCR/19-58:0.63233):1.15464,((Q8X1X8_PARBR/63-99:0.38545,Q95Z06_9TRYP/254-290:0.00000):0.48807,((((CLH_DICDI/251-287:0.28316,(CLH_RAT/253-288:0.12521,Q7PQY9_ANOGA/253-288:0.15342):0.03666):0.04847,(Q7SHV2_NEUCR/257-292:0.09925,CLH_CAEEL/251-286:0.47546):0.04619):0.07889,CLH_SCHPO/251-286:0.41575):0.30013,Q9C6U0_ARATH/76-111:0.11725):0.80249):0.95557):0.13240,((((Q8UUQ9_CHICK/31-65:0.10978,CLH2_HUMAN/296-330:0.10638):0.08112,CLH_DROME/296-330:0.06261):0.00000,(CLH_CAEEL/294-328:0.17949,Q7SHV2_NEUCR/300-334:0.45367):0.12947):0.17498,((Q7RNG3_PLAYO/314-348:0.96998,((CLH_SCHPO/294-328:0.04841,Q9C6U0_ARATH/119-153:0.66167):0.20117,((Q8X1X8_PARBR/107-141:0.21151,Q95Z06_9TRYP/298-332:0.11002):1.02379,CLH_YEAST/302-336:0.33891):0.25839):0.00000):0.07382,CLH_DICDI/295-329:0.12090):0.00000):1.03578):0.40452,(((((((CLH_RAT/198-234:0.09161,CLH2_HUMAN/198-234:0.17616):0.03599,(CLH_CAEEL/196-232:0.26823,((Q9C6U0_ARATH/18-58:0.10641,Q39834_SOYBN/208-247:0.13215):0.21006,CLH_DICDI/198-234:0.61728):0.17429):0.20317):0.04527,Q7PQY9_ANOGA/198-234:0.13964):0.08554,CLH_DROME/198-234:0.07853):0.43027,Q7SHV2_NEUCR/203-239:0.17073):0.18543,CLH_SCHPO/197-233:0.64578):0.52935,((((((CLH_RAT/60-94:0.07704,Q9CA00_ARATH/60-100:0.24170):0.11686,CLH_CAEEL/58-92:0.07252):0.07014,((CLH_DICDI/60-94:0.45466,Q8I5L6_PLAF7/59-99:0.44010):0.03598,CLH_YEAST/59-94:0.59953):0.40052):0.03677,(Q7SHV2_NEUCR/62-97:0.19378,CLH_SCHPO/60-94:0.18154):0.12811):0.47001,Q95Z06_9TRYP/61-95:0.19294):0.73989,((((Q9CA00_ARATH/154-197:0.15169,Q39834_SOYBN/154-197:0.10188):0.38273,(Q7SHV2_NEUCR/153-192:0.25551,((CLH_RAT/148-187:0.09466,CLH_DROME/148-187:0.25337):0.07751,CLH_CAEEL/146-185:0.21984):0.09156):0.13735):0.04248,CLH_DICDI/148-187:0.20804):0.09674,((Q8I5L6_PLAF7/107-138:0.00000,(((Q95Z06_9TRYP/103-134:0.51237,CLH_SCHPO/102-133:0.36943):0.14124,(((CLH_DICDI/102-133:0.31862,((CLH_RAT/102-133:0.14585,CLH2_HUMAN/102-133:0.14104):0.15082,CLH_DROME/102-133:0.00000):0.07940):0.12228,Q9CA00_ARATH/108-139:0.25373):0.06441,Q7SHV2_NEUCR/105-136:0.49917):0.08342):0.03223,CLH_CAEEL/100-131:0.14654):0.80462):2.67653,((CLH_YEAST/151-190:0.43689,CLH_SCHPO/147-186:0.35447):0.20795,Q8I5L6_PLAF7/183-224:0.82804):0.00000):0.00000):1.91801):0.44176):0.47971):50.00000,Q8X1X8_PARBR/12-43:0.17400,Q95Z06_9TRYP/203-234:0.14470);
ATP  ((((((((((CLH_CAEEL/17-54,Q9CA00_ARATH/20-56),(CLH_RAT/19-56,CLH_DROME/19-56)),CLH_DICDI/18-56),Q95Z06_9TRYP/19-57),(CLH_YEAST/18-55,CLH_SCHPO/19-56)),Q7SHV2_NEUCR/19-58),((Q8X1X8_PARBR/63-99,Q95Z06_9TRYP/254-290),((((CLH_DICDI/251-287,(CLH_RAT/253-288,Q7PQY9_ANOGA/253-288)),(Q7SHV2_NEUCR/257-292,CLH_CAEEL/251-286)),CLH_SCHPO/251-286),Q9C6U0_ARATH/76-111))),((((Q8UUQ9_CHICK/31-65,CLH2_HUMAN/296-330),CLH_DROME/296-330),(CLH_CAEEL/294-328,Q7SHV2_NEUCR/300-334)),((Q7RNG3_PLAYO/314-348,((CLH_SCHPO/294-328,Q9C6U0_ARATH/119-153),((Q8X1X8_PARBR/107-141,Q95Z06_9TRYP/298-332),CLH_YEAST/302-336))),CLH_DICDI/295-329))),(((((((CLH_RAT/198-234,CLH2_HUMAN/198-234),(CLH_CAEEL/196-232,((Q9C6U0_ARATH/18-58,Q39834_SOYBN/208-247),CLH_DICDI/198-234))),Q7PQY9_ANOGA/198-234),CLH_DROME/198-234),Q7SHV2_NEUCR/203-239),CLH_SCHPO/197-233),((((((CLH_RAT/60-94,Q9CA00_ARATH/60-100),CLH_CAEEL/58-92),((CLH_DICDI/60-94,Q8I5L6_PLAF7/59-99),CLH_YEAST/59-94)),(Q7SHV2_NEUCR/62-97,CLH_SCHPO/60-94)),Q95Z06_9TRYP/61-95),((((Q9CA00_ARATH/154-197,Q39834_SOYBN/154-197),(Q7SHV2_NEUCR/153-192,((CLH_RAT/148-187,CLH_DROME/148-187),CLH_CAEEL/146-185))),CLH_DICDI/148-187),((Q8I5L6_PLAF7/107-138,(((Q95Z06_9TRYP/103-134,CLH_SCHPO/102-133),(((CLH_DICDI/102-133,((CLH_RAT/102-133,CLH2_HUMAN/102-133),CLH_DROME/102-133)),Q9CA00_ARATH/108-139),Q7SHV2_NEUCR/105-136)),CLH_CAEEL/100-131)),((CLH_YEAST/151-190,CLH_SCHPO/147-186),Q8I5L6_PLAF7/183-224)))))),Q8X1X8_PARBR/12-43,Q95Z06_9TRYP/203-234);
ATL  44.012
DNO  71
DLN  132
DID  0.331383
DPH  (((((((CLH_SCHPO/19-56:0.30149,(Q9CA00_ARATH/20-56:0.26004,(CLH_DICDI/18-56:0.26073,(CLH_YEAST/18-55:0.41240,Q95Z06_9TRYP/19-57:0.35754):0.11384):0.06192):0.07343):0.06538,CLH_CAEEL/17-54:0.27957):0.10605,(CLH_DROME/19-56:0.21834,(CLH_RAT/19-56:0.21973,Q7SHV2_NEUCR/19-58:0.44057):0.04845):0.16895):0.57601,((Q8X1X8_PARBR/63-99:0.29453,Q95Z06_9TRYP/254-290:0.19208):0.37262,(Q9C6U0_ARATH/76-111:0.07693,(((CLH_CAEEL/251-286:0.31676,CLH_DICDI/251-287:0.20152):0.09505,((Q7SHV2_NEUCR/257-292:0.12488,Q7PQY9_ANOGA/253-288:0.17176):0.15351,CLH_RAT/253-288:0.14643):0.07516):0.12352,CLH_SCHPO/251-286:0.28968):0.19799):0.34940):0.30051):0.15069,((((Q8X1X8_PARBR/107-141:0.23503,Q95Z06_9TRYP/298-332:0.17357):0.20475,((CLH_SCHPO/102-133:0.14885,((Q7SHV2_NEUCR/105-136:0.30908,(((CLH_RAT/102-133:0.13005,CLH2_HUMAN/102-133:0.21236):0.12328,CLH_DROME/102-133:0.12678):0.06700,(CLH_CAEEL/100-131:0.23106,(CLH_DICDI/102-133:0.36121,Q9CA00_ARATH/108-139:0.14974):0.15658):0.14598):0.09691):0.11742,(Q8I5L6_PLAF7/107-138:0.35593,Q95Z06_9TRYP/103-134:0.27749):0.16097):0.09224):0.32339,(Q8I5L6_PLAF7/183-224:0.16391,((CLH_YEAST/151-190:0.36262,(CLH_DICDI/148-187:0.29895,(((Q9CA00_ARATH/154-197:0.10021,Q39834_SOYBN/154-197:0.19084):0.32510,(Q7SHV2_NEUCR/153-192:0.29422,(CLH_RAT/148-187:0.13755,CLH_DROME/148-187:0.26182):0.10702):0.13765):0.07372,CLH_CAEEL/146-185:0.23631):0.11203):0.10229):0.14466,CLH_SCHPO/147-186:0.33986):0.26914):0.80442):0.58530):0.35870,Q7SHV2_NEUCR/300-334:0.25595):0.06002,(((CLH_YEAST/302-336:0.57936,((Q8UUQ9_CHICK/31-65:0.23316,CLH2_HUMAN/296-330:0.09461):0.14196,(Q9C6U0_ARATH/119-153:0.56580,(Q7RNG3_PLAYO/314-348:0.61431,CLH_DICDI/295-329:0.14089):0.09693):0.07540):0.05449):0.06520,(CLH_CAEEL/294-328:0.20275,CLH_SCHPO/294-328:0.31480):0.06716):0.12572,CLH_DROME/296-330:0.12825):0.02801):0.55368):0.03783,(((CLH_SCHPO/197-233:0.61069,Q7SHV2_NEUCR/203-239:0.05593):0.14700,(CLH_DROME/198-234:0.07627,(Q7PQY9_ANOGA/198-234:0.14631,(((CLH_RAT/198-234:0.19485,CLH2_HUMAN/198-234:0.20373):0.06667,(CLH_CAEEL/196-232:0.22465,(Q9C6U0_ARATH/18-58:0.24525,Q39834_SOYBN/208-247:0.06497):0.27125):0.16663):0.04414,CLH_DICDI/198-234:0.68689):0.10670):0.16379):0.25630):0.09193,((CLH_YEAST/59-94:0.46755,(Q7SHV2_NEUCR/62-97:0.34202,(((((CLH_DICDI/60-94:0.18363,Q8I5L6_PLAF7/59-99:0.29754):0.39531,Q9CA00_ARATH/60-100:0.19034):0.09321,CLH_RAT/60-94:0.12879):0.08115,CLH_CAEEL/58-92:0.22596):0.12919,CLH_SCHPO/60-94:0.21799):0.09001):0.13937):0.23193,Q95Z06_9TRYP/61-95:0.18628):0.62985):0.18819):1.50085,Q8X1X8_PARBR/12-43:0.19334,Q95Z06_9TRYP/203-234:0.17958);
DTP  (((((((CLH_SCHPO/19-56,(Q9CA00_ARATH/20-56,(CLH_DICDI/18-56,(CLH_YEAST/18-55,Q95Z06_9TRYP/19-57)))),CLH_CAEEL/17-54),(CLH_DROME/19-56,(CLH_RAT/19-56,Q7SHV2_NEUCR/19-58))),((Q8X1X8_PARBR/63-99,Q95Z06_9TRYP/254-290),(Q9C6U0_ARATH/76-111,(((CLH_CAEEL/251-286,CLH_DICDI/251-287),((Q7SHV2_NEUCR/257-292,Q7PQY9_ANOGA/253-288),CLH_RAT/253-288)),CLH_SCHPO/251-286)))),((((Q8X1X8_PARBR/107-141,Q95Z06_9TRYP/298-332),((CLH_SCHPO/102-133,((Q7SHV2_NEUCR/105-136,(((CLH_RAT/102-133,CLH2_HUMAN/102-133),CLH_DROME/102-133),(CLH_CAEEL/100-131,(CLH_DICDI/102-133,Q9CA00_ARATH/108-139)))),(Q8I5L6_PLAF7/107-138,Q95Z06_9TRYP/103-134))),(Q8I5L6_PLAF7/183-224,((CLH_YEAST/151-190,(CLH_DICDI/148-187,(((Q9CA00_ARATH/154-197,Q39834_SOYBN/154-197),(Q7SHV2_NEUCR/153-192,(CLH_RAT/148-187,CLH_DROME/148-187))),CLH_CAEEL/146-185))),CLH_SCHPO/147-186)))),Q7SHV2_NEUCR/300-334),(((CLH_YEAST/302-336,((Q8UUQ9_CHICK/31-65,CLH2_HUMAN/296-330),(Q9C6U0_ARATH/119-153,(Q7RNG3_PLAYO/314-348,CLH_DICDI/295-329)))),(CLH_CAEEL/294-328,CLH_SCHPO/294-328)),CLH_DROME/296-330))),(((CLH_SCHPO/197-233,Q7SHV2_NEUCR/203-239),(CLH_DROME/198-234,(Q7PQY9_ANOGA/198-234,(((CLH_RAT/198-234,CLH2_HUMAN/198-234),(CLH_CAEEL/196-232,(Q9C6U0_ARATH/18-58,Q39834_SOYBN/208-247))),CLH_DICDI/198-234)))),((CLH_YEAST/59-94,(Q7SHV2_NEUCR/62-97,(((((CLH_DICDI/60-94,Q8I5L6_PLAF7/59-99),Q9CA00_ARATH/60-100),CLH_RAT/60-94),CLH_CAEEL/58-92),CLH_SCHPO/60-94))),Q95Z06_9TRYP/61-95))),Q8X1X8_PARBR/12-43,Q95Z06_9TRYP/203-234);
DTL  31.6699
RID  0.155812
RPH  ((((((((((CLH_CAEEL/17-54:0.35139,Q9CA00_ARATH/20-56:0.18927):0.13085,(CLH_RAT/19-56:0.10753,CLH_DROME/19-56:0.14821):0.11758):0.06558,CLH_DICDI/18-56:0.21921):0.25503,Q95Z06_9TRYP/19-57:0.45824):0.02523,(CLH_YEAST/18-55:0.71826,CLH_SCHPO/19-56:0.27939):0.02023):0.06641,Q7SHV2_NEUCR/19-58:0.63233):1.15464,((Q8X1X8_PARBR/63-99:0.38545,Q95Z06_9TRYP/254-290:0.00000):0.48807,((((CLH_DICDI/251-287:0.28316,(CLH_RAT/253-288:0.12521,Q7PQY9_ANOGA/253-288:0.15342):0.03666):0.04847,(Q7SHV2_NEUCR/257-292:0.09925,CLH_CAEEL/251-286:0.47546):0.04619):0.07889,CLH_SCHPO/251-286:0.41575):0.30013,Q9C6U0_ARATH/76-111:0.11725):0.80249):0.95557):0.13240,((((Q8UUQ9_CHICK/31-65:0.10978,CLH2_HUMAN/296-330:0.10638):0.08112,CLH_DROME/296-330:0.06261):0.00000,(CLH_CAEEL/294-328:0.17949,Q7SHV2_NEUCR/300-334:0.45367):0.12947):0.17498,((Q7RNG3_PLAYO/314-348:0.96998,((CLH_SCHPO/294-328:0.04841,Q9C6U0_ARATH/119-153:0.66167):0.20117,((Q8X1X8_PARBR/107-141:0.21151,Q95Z06_9TRYP/298-332:0.11002):1.02379,CLH_YEAST/302-336:0.33891):0.25839):0.00000):0.07382,CLH_DICDI/295-329:0.12090):0.00000):1.03578):0.40452,(((((((CLH_RAT/198-234:0.09161,CLH2_HUMAN/198-234:0.17616):0.03599,(CLH_CAEEL/196-232:0.26823,((Q9C6U0_ARATH/18-58:0.10641,Q39834_SOYBN/208-247:0.13215):0.21006,CLH_DICDI/198-234:0.61728):0.17429):0.20317):0.04527,Q7PQY9_ANOGA/198-234:0.13964):0.08554,CLH_DROME/198-234:0.07853):0.43027,Q7SHV2_NEUCR/203-239:0.17073):0.18543,CLH_SCHPO/197-233:0.64578):0.52935,((((((CLH_RAT/60-94:0.07704,Q9CA00_ARATH/60-100:0.24170):0.11686,CLH_CAEEL/58-92:0.07252):0.07014,((CLH_DICDI/60-94:0.45466,Q8I5L6_PLAF7/59-99:0.44010):0.03598,CLH_YEAST/59-94:0.59953):0.40052):0.03677,(Q7SHV2_NEUCR/62-97:0.19378,CLH_SCHPO/60-94:0.18154):0.12811):0.47001,Q95Z06_9TRYP/61-95:0.19294):0.73989,((((Q9CA00_ARATH/154-197:0.15169,Q39834_SOYBN/154-197:0.10188):0.38273,(Q7SHV2_NEUCR/153-192:0.25551,((CLH_RAT/148-187:0.09466,CLH_DROME/148-187:0.25337):0.07751,CLH_CAEEL/146-185:0.21984):0.09156):0.13735):0.04248,CLH_DICDI/148-187:0.20804):0.09674,((Q8I5L6_PLAF7/107-138:0.00000,(((Q95Z06_9TRYP/103-134:0.51237,CLH_SCHPO/102-133:0.36943):0.14124,(((CLH_DICDI/102-133:0.31862,((CLH_RAT/102-133:0.14585,CLH2_HUMAN/102-133:0.14104):0.15082,CLH_DROME/102-133:0.00000):0.07940):0.12228,Q9CA00_ARATH/108-139:0.25373):0.06441,Q7SHV2_NEUCR/105-136:0.49917):0.08342):0.03223,CLH_CAEEL/100-131:0.14654):0.80462):2.67653,((CLH_YEAST/151-190:0.43689,CLH_SCHPO/147-186:0.35447):0.20795,Q8I5L6_PLAF7/183-224:0.82804):0.00000):0.00000):1.91801):0.44176):0.47971):50.00000,Q8X1X8_PARBR/12-43:0.17400,Q95Z06_9TRYP/203-234:0.14470);
RTP  ((((((((((CLH_CAEEL/17-54,Q9CA00_ARATH/20-56),(CLH_RAT/19-56,CLH_DROME/19-56)),CLH_DICDI/18-56),Q95Z06_9TRYP/19-57),(CLH_YEAST/18-55,CLH_SCHPO/19-56)),Q7SHV2_NEUCR/19-58),((Q8X1X8_PARBR/63-99,Q95Z06_9TRYP/254-290),((((CLH_DICDI/251-287,(CLH_RAT/253-288,Q7PQY9_ANOGA/253-288)),(Q7SHV2_NEUCR/257-292,CLH_CAEEL/251-286)),CLH_SCHPO/251-286),Q9C6U0_ARATH/76-111))),((((Q8UUQ9_CHICK/31-65,CLH2_HUMAN/296-330),CLH_DROME/296-330),(CLH_CAEEL/294-328,Q7SHV2_NEUCR/300-334)),((Q7RNG3_PLAYO/314-348,((CLH_SCHPO/294-328,Q9C6U0_ARATH/119-153),((Q8X1X8_PARBR/107-141,Q95Z06_9TRYP/298-332),CLH_YEAST/302-336))),CLH_DICDI/295-329))),(((((((CLH_RAT/198-234,CLH2_HUMAN/198-234),(CLH_CAEEL/196-232,((Q9C6U0_ARATH/18-58,Q39834_SOYBN/208-247),CLH_DICDI/198-234))),Q7PQY9_ANOGA/198-234),CLH_DROME/198-234),Q7SHV2_NEUCR/203-239),CLH_SCHPO/197-233),((((((CLH_RAT/60-94,Q9CA00_ARATH/60-100),CLH_CAEEL/58-92),((CLH_DICDI/60-94,Q8I5L6_PLAF7/59-99),CLH_YEAST/59-94)),(Q7SHV2_NEUCR/62-97,CLH_SCHPO/60-94)),Q95Z06_9TRYP/61-95),((((Q9CA00_ARATH/154-197,Q39834_SOYBN/154-197),(Q7SHV2_NEUCR/153-192,((CLH_RAT/148-187,CLH_DROME/148-187),CLH_CAEEL/146-185))),CLH_DICDI/148-187),((Q8I5L6_PLAF7/107-138,(((Q95Z06_9TRYP/103-134,CLH_SCHPO/102-133),(((CLH_DICDI/102-133,((CLH_RAT/102-133,CLH2_HUMAN/102-133),CLH_DROME/102-133)),Q9CA00_ARATH/108-139),Q7SHV2_NEUCR/105-136)),CLH_CAEEL/100-131)),((CLH_YEAST/151-190,CLH_SCHPO/147-186),Q8I5L6_PLAF7/183-224)))))),Q8X1X8_PARBR/12-43,Q95Z06_9TRYP/203-234);
RTL  44.012
LNK  CLH2_HUMAN/102-133:P53675:U41763
LNK  CLH2_HUMAN/198-234:P53675:X95486
LNK  CLH2_HUMAN/296-330:P53675:U41763
LNK  CLH_CAEEL/100-131:P34574:Z30423
LNK  CLH_CAEEL/146-185:P34574:Z30423
LNK  CLH_CAEEL/17-54:P34574:Z30423
LNK  CLH_CAEEL/196-232:P34574:Z30423
LNK  CLH_CAEEL/251-286:P34574:Z30423
LNK  CLH_CAEEL/294-328:P34574:Z30423
LNK  CLH_CAEEL/58-92:P34574:Z30423
LNK  CLH_DICDI/102-133:P25870:M83660
LNK  CLH_DICDI/148-187:P25870:M83660
LNK  CLH_DICDI/18-56:P25870:M83660
LNK  CLH_DICDI/198-234:P25870:M83660
LNK  CLH_DICDI/251-287:P25870:M83660
LNK  CLH_DICDI/295-329:P25870:M83660
LNK  CLH_DICDI/60-94:P25870:M83660
LNK  CLH_DROME/102-133:P29742:Z14133
LNK  CLH_DROME/148-187:P29742:Z14133
LNK  CLH_DROME/19-56:P29742:Z14133
LNK  CLH_DROME/198-234:P29742:Z14133
LNK  CLH_DROME/296-330:P29742:Z14133
LNK  CLH_RAT/102-133:P11442:J03583
LNK  CLH_RAT/148-187:P11442:J03583
LNK  CLH_RAT/19-56:P11442:J03583
LNK  CLH_RAT/198-234:P11442:J03583
LNK  CLH_RAT/253-288:P11442:J03583
LNK  CLH_RAT/60-94:P11442:J03583
LNK  CLH_SCHPO/102-133:Q10161:Z69240
LNK  CLH_SCHPO/147-186:Q10161:Z69240
LNK  CLH_SCHPO/19-56:Q10161:Z69240
LNK  CLH_SCHPO/197-233:Q10161:Z69240
LNK  CLH_SCHPO/251-286:Q10161:Z69240
LNK  CLH_SCHPO/294-328:Q10161:Z69240
LNK  CLH_SCHPO/60-94:Q10161:Z69240
LNK  CLH_YEAST/151-190:P22137:X52900
LNK  CLH_YEAST/18-55:P22137:X52900
LNK  CLH_YEAST/302-336:P22137:X52900
LNK  CLH_YEAST/59-94:P22137:X52900
LNK  Q39834_SOYBN/154-197:Q39834:U42608
LNK  Q39834_SOYBN/208-247:Q39834:U42608
LNK  Q7PQY9_ANOGA/198-234:Q7PQY9:AAAB01008859
LNK  Q7PQY9_ANOGA/253-288:Q7PQY9:AAAB01008859
LNK  Q7RNG3_PLAYO/314-348:Q7RNG3:AABL01000504
LNK  Q7SHV2_NEUCR/105-136:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/153-192:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/19-58:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/203-239:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/257-292:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/300-334:Q7SHV2:AABX01000002
LNK  Q7SHV2_NEUCR/62-97:Q7SHV2:AABX01000002
LNK  Q8I5L6_PLAF7/107-138:Q8I5L6:AE014847
LNK  Q8I5L6_PLAF7/183-224:Q8I5L6:AE014847
LNK  Q8I5L6_PLAF7/59-99:Q8I5L6:AE014847
LNK  Q8UUQ9_CHICK/31-65:Q8UUQ9:AJ429073
LNK  Q8X1X8_PARBR/107-141:Q8X1X8:AF441250
LNK  Q8X1X8_PARBR/12-43:Q8X1X8:AF441250
LNK  Q8X1X8_PARBR/63-99:Q8X1X8:AF441250
LNK  Q95Z06_9TRYP/103-134:Q95Z06:AJ278858
LNK  Q95Z06_9TRYP/19-57:Q95Z06:AJ278858
LNK  Q95Z06_9TRYP/203-234:Q95Z06:AJ278858
LNK  Q95Z06_9TRYP/254-290:Q95Z06:AJ278858
LNK  Q95Z06_9TRYP/298-332:Q95Z06:AJ278858
LNK  Q95Z06_9TRYP/61-95:Q95Z06:AJ278858
LNK  Q9C6U0_ARATH/119-153:Q9C6U0:AC074395
LNK  Q9C6U0_ARATH/18-58:Q9C6U0:AC074395
LNK  Q9C6U0_ARATH/76-111:Q9C6U0:AC074395
LNK  Q9CA00_ARATH/108-139:Q9CA00:AC012562
LNK  Q9CA00_ARATH/154-197:Q9CA00:AC012562
LNK  Q9CA00_ARATH/20-56:Q9CA00:AC012562
LNK  Q9CA00_ARATH/60-100:Q9CA00:AC012562
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7PQY9_ANOGA/253-288
ASQ  PPEA-QSDFPVAMQVSPRYDVIYL---.---ITKYGYIHMYDIE
DSQ  CCGCCGGAGGCG---CAGAGCGACTTCCCGGTCGCGATGCAGGTTTCGCCGCGGTACGACGTGATCTATCTG---------...---------ATCACCAAGTACGGGTACATCCACATGTACGACATCGAG
TRN  11011111101111111
NAM  CLH_RAT/253-288
ASQ  PPEA-QNDFPVAMQISEKHDVVFL---.---ITKYGYIHLYDLE
DSQ  CCTCCAGAAGCA---CAAAATGATTTTCCTGTTGCAATGCAGATCAGTGAAAAGCATGACGTGGTGTTCCTG---------...---------ATTACCAAGTATGGTTATATTCACCTCTATGACCTTGAG
TRN  11011111101111111
NAM  Q7SHV2_NEUCR/257-292
ASQ  PPEA-SNDFPVALQVSQKYGIIYL---.---ITKYGFIHLYDLE
DSQ  CCTCCCGAGGCC---AGCAATGACTTCCCCGTCGCCCTCCAGGTTTCGCAAAAGTACGGCATCATCTACCTT---------...---------ATCACCAAGTACGGTTTCATCCACCTCTACGACCTCGAG
TRN  11011111111111111
NAM  CLH_DICDI/251-287
ASQ  PPEIGASDFPVAMQVSEKYEVIYM---.---VTKLGYIHLFDLG
DSQ  CCACCAGAGATTGGTGCTTCCGATTTCCCAGTGGCAATGCAAGTCTCTGAAAAGTATGAAGTCATCTATATG---------...---------GTCACTAAATTGGGTTACATTCATCTCTTTGATTTGGGT
TRN  11011101111011011
NAM  CLH_SCHPO/251-286
ASQ  PPEA-VNDFPIAIEIGSTYNVAYV---.---VTKYGFIHVYDLE
DSQ  CCTCCGGAAGCC---GTTAATGATTTTCCTATTGCTATTGAAATTGGTTCCACTTATAACGTTGCTTATGTT---------...---------GTTACCAAATATGGCTTTATTCATGTTTATGATTTGGAA
TRN  11111101111011011
NAM  Q9C6U0_ARATH/76-111
ASQ  PPDF-ADDFPVAMQVSHKFNLIYV---.---ITKLGLLFVYDLE
DSQ  CCCCCTGATTTT---GCTGATGATTTTCCTGTTGCCATGCAGGTCTCTCACAAATTTAACTTGATATATGTT---------...---------ATCACCAAACTTGGCCTGTTGTTTGTGTACGATCTAGAG
TRN  10010101100011011
NAM  CLH_CAEEL/251-286
ASQ  TADT-AGDFPVSMQVSAKQGIIYL---.---VTKQGYVHLYDVE
DSQ  ACCGCTGACACA---GCTGGCGATTTTCCAGTGTCTATGCAGGTATCTGCGAAGCAAGGAATTATTTACCTG---------...---------GTAACAAAGCAAGGATATGTTCATCTTTATGATGTCGAG
TRN  11011111101111111
NAM  Q95Z06_9TRYP/254-290
ASQ  DVPFAQGDFPVATHVSPRHKLLTV---.---VTSRGSVVLMDLF
DSQ  GATGTCCCCTTTGCTCAGGGTGACTTTCCCGTTGCGACACACGTCTCACCACGACACAAACTCCTCACCGTT---------...---------GTGACAAGCCGTGGTAGCGTGGTGCTTATGGACCTCTTC
TRN  11011101111011001
NAM  Q8X1X8_PARBR/63-99
ASQ  DVAFPPGDFPVALTVSPRHKLLTI---.---MTSRGTAILMDIF
DSQ  GATGTCGCATTCCCACCTGGCGACTTTCCGGTCGCCTTGACCGTTTCCCCCCGGCACAAGTTGCTGACAATC---------...---------ATGACAAGCCGTGGAACCGCCATCTTGATGGATATATTT
TRN  10010111100111011
NAM  CLH_SCHPO/19-56
ASQ  GIQPSSFGFANVTLESDKYVCVRDN--.---PNGVNQVVIVDLE
DSQ  GGAATTCAACCGTCTTCTTTCGGATTTGCAAATGTAACCCTTGAATCTGACAAATATGTTTGTGTTCGCGATAAT------...---------CCAAATGGTGTAAACCAGGTCGTTATTGTCGATTTGGAA
TRN  11011101111011011
NAM  Q95Z06_9TRYP/19-57
ASQ  GLRPGTISFKTLTLQSDKYVCIRDVQ-.---PDGQTSLVIVDLG
DSQ  GGGTTGAGACCGGGAACCATTTCCTTCAAGACACTGACGCTGCAGAGCGACAAGTACGTTTGCATCCGCGATGTGCAA---...---------CCTGATGGTCAAACCTCTCTTGTTATCGTGGATCTCGGG
TRN  10010101100011011
NAM  Q9CA00_ARATH/20-56
ASQ  GINQQFITFTNVTMESDKYICVRETS-.-----PQNSVVIIDMN
DSQ  GGGATCAATCAGCAATTCATCACGTTTACAAATGTTACTATGGAGTCTGACAAGTATATCTGTGTACGAGAGACGTCA---...---------------CCGCAAAACAGTGTTGTAATTATAGATATGAAT
TRN  10010111110111001
NAM  CLH_CAEEL/17-54
ASQ  GIRVPNITFSNVTMESDKNIVVREMI-.---G-DQQQVVIIDLA
DSQ  GGAATTCGGGTGCCCAACATTACATTCTCCAATGTCACAATGGAATCTGATAAGAACATTGTTGTTCGTGAGATGATT---...---------GGT---GATCAACAACAGGTTGTGATTATTGATTTGGCC
TRN  11111111111111111
NAM  CLH_DROME/19-56
ASQ  GINANSFSFSTLTMESDKFICVREKV-.---N-DTAQVVIIDMN
DSQ  GGGATCAACGCCAATTCATTTTCATTCAGCACGCTCACGATGGAATCGGATAAGTTTATTTGCGTGCGGGAGAAGGTG---...---------AAT---GATACCGCCCAAGTGGTCATCATTGACATGAAC
TRN  11011111111111101
NAM  CLH_RAT/19-56
ASQ  GINPANIGFSTLTMESDKFICIREKV-.---G-EQAQVVIIDMN
DSQ  GGTATCAACCCAGCAAACATTGGCTTCAGTACCCTGACTATGGAGTCAGACAAATTCATCTGCATTAGAGAAAAAGTG---...---------GGA---GAGCAGGCTCAGGTGGTGATCATTGACATGAAT
TRN  10010101100011001
NAM  CLH_DICDI/18-56
ASQ  GIGSNSIGFSTLTMESEKYICIRETT-.---PDDKNNVVIIDTD
DSQ  GGTATTGGATCCAATTCAATTGGTTTTTCAACCTTAACAATGGAGAGTGAAAAATACATTTGTATTCGTGAAACTACA---...---------CCAGATGATAAAAATAATGTTGTAATTATTGATACTGAC
TRN  11111101111011000
NAM  CLH_YEAST/18-55
ASQ  GISPQFLDFRSTTFESDHFVTVRET--.---KDGTNSVAIVDLA
DSQ  GGAATTTCCCCTCAATTCCTTGACTTCAGATCAACTACTTTCGAGAGTGACCACTTCGTCACTGTTAGAGAAACA------...---------AAGGACGGTACAAACTCTGTTGCAATCGTGGATTTGGCC
TRN  10010101110011001
NAM  Q7SHV2_NEUCR/19-58
ASQ  GINQTAITFNTCTLESDNWVCIRDKK-.--DEAASPEVIIVDLK
DSQ  GGCATCAACCAGACTGCCATCACTTTCAATACCTGTACTCTAGAATCGGACAACTGGGTGTGTATTCGCGACAAGAAG---...------GACGAGGCAGCGTCCCCTGAAGTCATCATCGTCGATCTCAAG
TRN  11011111111111111
NAM  Q7PQY9_ANOGA/198-234
ASQ  AASFATFKMEENKELSTLFCFAVR---.---SQTAAKLHIIEVG
DSQ  GCGGCCTCGTTCGCTACCTTCAAGATGGAGGAAAACAAGGAACTGTCGACGCTGTTCTGCTTTGCCGTCCGG---------...---------TCGCAAACGGCAGCGAAGCTGCACATCATCGAGGTCGGC
TRN  11011111101111111
NAM  CLH_DROME/198-234
ASQ  AASFATFKIDANKEPTTLFCFAVR---.---TATGGKLHIIEVG
DSQ  GCGGCCAGTTTTGCCACGTTTAAAATCGATGCCAACAAGGAGCCGACCACGCTGTTCTGCTTTGCAGTTCGT---------...---------ACGGCCACTGGGGGCAAGCTTCATATTATCGAAGTTGGT
TRN  11011101101011011
NAM  CLH2_HUMAN/198-234
ASQ  AAAFAEFKMEGNAKPATLFCFAVR---.---NPTGGKLHIIEVG
DSQ  GCTGCGGCTTTTGCAGAGTTCAAGATGGAGGGGAATGCCAAGCCTGCCACCCTTTTCTGCTTTGCTGTACGT---------...---------AATCCCACAGGAGGCAAGTTGCACATCATTGAAGTTGGA
TRN  11011111111111111
NAM  CLH_RAT/198-234
ASQ  AASFAQFKMEGNAEESTLFCFAVR---.---GQAGGKLHIIEVG
DSQ  GCGGCGAGTTTTGCACAATTTAAGATGGAAGGAAACGCAGAAGAATCGACGTTATTTTGTTTTGCTGTGCGG---------...---------GGTCAGGCAGGGGGGAAGTTACATATCATTGAAGTTGGT
TRN  11111111111111110
NAM  CLH_CAEEL/196-232
ASQ  AACFVRFKVDGNQNPSNLFCFSVK---.---TDNGGKLHVIEVG
DSQ  GCCGCTTGCTTCGTTCGATTCAAGGTCGATGGAAACCAAAACCCATCTAACTTATTCTGTTTTTCCGTCAAA---------...---------ACCGATAATGGAGGAAAATTGCACGTTATTGAAGTAGGA
TRN  11111101111011010
NAM  Q39834_SOYBN/208-247
ASQ  AASFAQFKVPGNENPSTLFLFATN-PN.--AGQIITKLHVIELG
DSQ  GCTGCATCATTTGCTCAATTCAAAGTTCCTGGGAATGAAAACCCATCTACTTTGTTTCTTTTTGCCACGAAC---CCTAAT...------GCTGGTCAAATTATAACCAAGTTGCATGTTATTGAGCTGGGT
TRN  10010101100011001
NAM  Q9C6U0_ARATH/18-58
ASQ  AASFAQFKVPGNENPSILISFASKSFN.--AGQITSKLHVIELG
DSQ  GCTGCATCGTTTGCGCAGTTTAAGGTTCCTGGGAATGAGAATCCTTCTATTCTTATATCATTTGCAAGCAAGAGCTTTAAT...------GCTGGGCAGATAACATCAAAGTTGCATGTCATTGAGCTTGGT
TRN  10010111110111001
NAM  Q7SHV2_NEUCR/203-239
ASQ  AAAFGTLRLEGAPEDTKVFTFAVR---.---TAVGAKLHIVEVD
DSQ  GCCGCTGCTTTTGGCACCCTCCGACTAGAGGGCGCCCCGGAGGACACCAAGGTGTTTACCTTTGCGGTCCGC---------...---------ACCGCCGTCGGCGCGAAGCTCCACATTGTCGAGGTCGAC
TRN  11011111111111111
NAM  CLH_DICDI/198-234
ASQ  AACFANYIVPGATRPSTLFAISSR---.---TQNASKILVLEVS
DSQ  GCAGCATGTTTTGCCAACTACATTGTACCAGGTGCAACTAGACCATCAACATTGTTTGCAATTTCATCACGT---------...---------ACTCAAAATGCATCAAAGATATTGGTATTGGAGGTTAGT
TRN  10010101110011001
NAM  CLH_SCHPO/197-233
ASQ  ASAFAVIQPEGVDHEVQVLALASR---.---LPTGSKLSIVEVD
DSQ  GCTTCTGCATTTGCAGTCATTCAACCAGAAGGCGTTGATCATGAAGTTCAAGTTTTAGCACTTGCCAGTCGA---------...---------TTACCCACAGGCTCGAAACTTAGTATTGTTGAGGTAGAC
TRN  11011101111011010
NAM  CLH_SCHPO/60-94
ASQ  NVLRRPISADSVILHPKKKIIALKAQ-.-------RQLQVFDLE
DSQ  AATGTGTTGCGACGTCCTATTTCGGCAGATTCAGTTATCTTACATCCCAAAAAGAAAATTATTGCATTAAAAGCACAA---...---------------------AGACAACTTCAAGTATTCGACTTGGAA
TRN  10010101110011000
NAM  Q7SHV2_NEUCR/62-97
ASQ  NVIRRPIKADSAIMHWTRQVIALKAQA.-------RTLQIFDLE
DSQ  AATGTTATCCGACGTCCCATCAAGGCCGACAGTGCCATAATGCACTGGACGCGCCAAGTAATTGCCCTCAAGGCCCAGGCG...---------------------CGCACACTCCAGATTTTCGACCTCGAA
TRN  10010111110111011
NAM  Q9CA00_ARATH/60-100
ASQ  QPLRRPITADSALMNPNSKILALKAQV.--PGTTQDHLQIFNIE
DSQ  CAGCCTCTTAGGAGGCCTATTACTGCAGACTCTGCTCTTATGAACCCAAACTCGAAGATCCTTGCCTTGAAAGCTCAAGTT...------CCAGGAACTACTCAGGATCATCTACAGATATTTAACATTGAA
TRN  10010101110011011
NAM  CLH_CAEEL/58-92
ASQ  NPTRRPISADSVIMHPTAKILALKS--.---GKT---LQIFNIE
DSQ  AATCCAACTCGTCGTCCAATTTCTGCTGACTCAGTAATCATGCACCCAACTGCCAAAATTCTTGCTTTGAAATCT------...---------GGCAAGACA---------CTTCAAATTTTCAATATTGAG
TRN  11011101111011001
NAM  CLH_RAT/60-94
ASQ  NPIRRPISADSAIMNPASKVIALKA--.---GKT---LQIFNIE
DSQ  AATCCGATTCGAAGACCAATCTCAGCAGACAGTGCCATCATGAATCCTGCCAGCAAAGTGATTGCACTGAAAGCT------...---------GGAAAAACT---------CTACAGATATTTAACATTGAA
TRN  10010101100011001
NAM  Q8I5L6_PLAF7/59-99
ASQ  NSTRKHMKAESVIIHPNDPILALKGTI.--KNMNTIFLQVFNIE
DSQ  AATAGTACTCGTAAGCATATGAAAGCAGAAAGTGTAATTATTCATCCAAATGACCCAATATTAGCATTAAAAGGAACCATA...------AAAAATATGAATACTATTTTTTTACAAGTATTCAATATTGAA
TRN  10010101110011010
NAM  CLH_DICDI/60-94
ASQ  QILRKQMKTDAAIMNPKEPILALK---.-----IGQVLQLISIE
DSQ  CAAATTCTTAGAAAACAAATGAAAACAGATGCTGCAATTATGAATCCAAAAGAACCAATTTTAGCATTAAAA---------...---------------ATTGGACAAGTTTTACAATTAATTTCAATTGAA
TRN  10010101110011000
NAM  Q95Z06_9TRYP/61-95
ASQ  SMRNSIRDAESAIMNPMAKILALR---.-----SGRNLQIFDVD
DSQ  AGCATGCGCAACAGTATACGTGATGCGGAGTCAGCCATCATGAATCCTATGGCAAAGATTCTTGCACTCCGC---------...---------------AGCGGCCGCAACTTGCAGATATTCGACGTGGAC
TRN  10010111110111001
NAM  CLH_YEAST/59-94
ASQ  EVTRKNMGGDSAIMHPSQMVISVR---.----ANGTIVQIFNLE
DSQ  GAAGTGACAAGGAAGAATATGGGCGGTGATTCTGCTATCATGCATCCATCTCAGATGGTTATTTCCGTTAGA---------...------------GCAAATGGTACTATCGTGCAGATATTTAATTTGGAA
TRN  10010101110011011
NAM  Q39834_SOYBN/154-197
ASQ  LPNNQIINYRCDPTEKWLVLIGILHGSpERPQLVKGRMQLFSVE
DSQ  CTGCCAAACAACCAAATAATTAATTATAGATGTGATCCTACAGAGAAATGGTTGGTCTTGATTGGTATTCTCCATGGTTCCcctGAGAGGCCACAATTGGTAAAAGGAAGAATGCAACTCTTCTCTGTGGAA
TRN  10010101100011011
NAM  Q9CA00_ARATH/154-197
ASQ  LANNQIINYKCSPNEKWLVLIGIAPGSpERQQLVKGNMQLFSVD
DSQ  TTGGCCAACAATCAAATTATAAACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTTTTAATTGGAATTGCTCCTGGCTCTcctGAGAGACAACAATTGGTAAAAGGAAATATGCAGCTTTTCTCTGTGGAT
TRN  10010101110011010
NAM  CLH_CAEEL/146-185
ASQ  LAGTQIINYRADAENKWLVLIGIS---.AKDSRVVGSMQLYSTE
DSQ  TTGGCCGGAACTCAAATCATAAATTATCGCGCTGATGCCGAAAACAAGTGGCTCGTTCTTATTGGAATTTCC---------...GCAAAAGACTCCCGTGTCGTTGGAAGTATGCAATTGTACAGTACCGAG
TRN  10010101110011011
NAM  CLH_DROME/148-187
ASQ  LNGCQIINYRCNASQQWLLLVGIS---.ALPSRVAGAMQLYSVE
DSQ  CTGAACGGTTGTCAAATCATCAACTACCGCTGCAATGCCTCCCAGCAGTGGCTACTCTTGGTCGGCATTTCG---------...GCACTGCCAAGTCGCGTTGCCGGTGCCATGCAGTTGTATTCGGTGGAG
TRN  11011111101111111
NAM  CLH_RAT/148-187
ASQ  LAGCQIINYRTDAKQKWLLLTGIS---.AQQNRVVGAMQLYSVD
DSQ  CTCGCAGGGTGCCAGATCATCAATTACCGTACAGATGCTAAGCAGAAGTGGTTGCTCCTGACTGGCATATCT---------...GCACAGCAAAATCGCGTGGTTGGAGCTATGCAGCTGTATTCTGTAGAC
TRN  10010111100111011
NAM  Q7SHV2_NEUCR/153-192
ASQ  LQGNQIINYRTSADGKWMVVVGIS---.QQQGRVVGAMQLYSKD
DSQ  CTCCAGGGCAACCAAATAATTAATTATCGGACCAGCGCCGACGGAAAGTGGATGGTTGTTGTCGGTATCTCA---------...CAACAGCAGGGCCGCGTTGTTGGCGCCATGCAGCTCTATTCCAAAGAC
TRN  10010101110011001
NAM  CLH_DICDI/148-187
ASQ  LQNTEIINYRSDSTQNWLVLVAIH---.QRDGRVVGRIQLYSVE
DSQ  TTACAAAATACAGAGATTATAAACTATCGTTCAGATAGCACACAAAATTGGTTAGTTTTAGTAGCAATTCAT---------...CAAAGAGATGGACGTGTAGTTGGTCGTATTCAATTATACTCTGTAGAG
TRN  10010101110011000
NAM  CLH_SCHPO/147-186
ASQ  LNGTQIISYKSNYNEEWFTLIGIS---.SRDNRIAGNLQLYSKK
DSQ  TTGAATGGAACGCAGATCATTTCCTACAAGAGCAACTATAATGAAGAATGGTTTACATTGATCGGTATTTCC---------...TCCCGGGATAACCGTATTGCTGGCAATCTTCAACTGTATTCCAAAAAG
TRN  11011101101011011
NAM  CLH_YEAST/151-190
ASQ  LNNTQIINFVANKNLDWFAVVGIL---.QENGRIAGRIQLFSKQ
DSQ  TTGAACAATACCCAAATTATCAATTTTGTGGCTAACAAAAACCTTGACTGGTTCGCAGTTGTTGGTATCTTA---------...CAAGAAAATGGCCGTATTGCCGGTAGAATTCAATTATTCTCAAAACAA
TRN  10010101110011000
NAM  Q8I5L6_PLAF7/183-224
ASQ  DNNSQILYYSTDKDMKWCILCGISTQ-.DQGKSIDGYMQLYSCE
DSQ  GACAATAACTCACAGATTTTATATTATTCTACCGATAAAGATATGAAATGGTGTATTTTATGTGGTATATCTACACAA---...GACCAAGGGAAAAGTATTGATGGTTATATGCAACTTTATTCTTGTGAA
TRN  10010101110011000
NAM  CLH_SCHPO/294-328
ASQ  NRVSGESIFVTTAHKSVNGLMAIN---.-----RKGQVLSVSIN
DSQ  AATCGTGTTTCGGGTGAATCAATCTTTGTAACCACTGCTCATAAATCTGTGAATGGTCTTATGGCCATTAAC---------...---------------CGAAAGGGTCAAGTTCTTAGCGTATCCATAAAC
TRN  10010101110011001
NAM  CLH2_HUMAN/296-330
ASQ  NRISADTIFVTAPHKPTSGIIGVN---.-----KKGQVLSVCVE
DSQ  AACCGTATTAGTGCTGACACAATATTTGTCACTGCTCCACACAAACCAACCTCTGGAATTATTGGTGTCAAC---------...---------------AAAAAGGGACAGGTACTGTCAGTTTGTGTTGAG
TRN  10010101100011001
NAM  CLH_DROME/296-330
ASQ  NRISADTIFVTAPHEASGGIIGVN---.-----RKGQVLSVTVD
DSQ  AATCGTATATCGGCCGATACGATCTTTGTTACCGCACCGCATGAGGCAAGTGGCGGCATCATTGGCGTCAAT---------...---------------CGCAAGGGACAGGTCCTCTCCGTGACCGTCGAC
TRN  10010111110111011
NAM  Q8UUQ9_CHICK/31-65
ASQ  NRISGETIFVTAQHEATAGIIGVN---.-----RKGQVLSVCVE
DSQ  AACAGAATCAGTGGAGAGACCATATTTGTTACTGCACAGCATGAAGCAACAGCTGGAATTATAGGAGTAAAC---------...---------------AGGAAGGGACAAGTGTTATCAGTTTGTGTGGAA
TRN  10010101110011000
NAM  CLH_DICDI/295-329
ASQ  NRISNENIFVTAFEESTNGIIAVN---.-----RKGQVLSVSID
DSQ  AATCGTATTAGCAATGAAAATATATTTGTAACTGCTTTCGAAGAGAGCACCAACGGTATCATTGCCGTCAAT---------...---------------AGAAAGGGTCAAGTCTTATCGGTTTCAATCGAT
TRN  10010101110011000
NAM  CLH_CAEEL/294-328
ASQ  NRISTDTVFVTCEYTATGGIMGIN---.-----RKGQVLSVSID
DSQ  AATCGAATTTCGACTGATACCGTATTTGTGACCTGTGAATACACAGCTACAGGAGGAATAATGGGAATTAAC---------...---------------AGAAAGGGACAAGTTCTTTCCGTCTCTATCGAT
TRN  10010101110011011
NAM  Q7SHV2_NEUCR/300-334
ASQ  NRISSDTIFTACGDKDSTGVIGIN---.-----RKGQVLFVSAD
DSQ  AACCGCATCTCAAGCGATACTATCTTCACTGCTTGCGGTGACAAGGATTCGACCGGCGTCATTGGCATCAAC---------...---------------CGCAAGGGACAGGTTCTCTTCGTCAGCGCCGAT
TRN  11011111111111101
NAM  Q9C6U0_ARATH/119-153
ASQ  NRISPDPIFLTSEASSVGGFYAIN---.-----RRGQVLLATVN
DSQ  AATCGGATTAGTCCAGACCCAATTTTCTTGACTTCTGAAGCTTCCTCAGTTGGGGGTTTCTATGCCATTAAT---------...---------------AGGCGAGGACAAGTTCTTTTGGCTACAGTAAAC
TRN  10010101110011001
NAM  CLH_YEAST/302-336
ASQ  NRITAESVFTAAPYNHENGIACIN---.-----KKGQVLAVEIS
DSQ  AATAGAATTACAGCAGAATCTGTTTTTACTGCAGCTCCGTACAATCACGAGAACGGTATTGCATGCATCAAT---------...---------------AAAAAAGGTCAAGTTTTAGCAGTAGAGATTTCT
TRN  10110101110011010
NAM  Q7RNG3_PLAYO/314-348
ASQ  EKISDDNIFICCDNKNGEGIIAVN---.-----KKGKIYYITLN
DSQ  GAAAAAATAAGTGATGATAATATATTTATATGTTGTGATAACAAAAATGGTGAAGGAATAATTGCAGTAAAT---------...---------------AAAAAAGGAAAAATATATTATATAACATTAAAT
TRN  10010101110011010
NAM  Q95Z06_9TRYP/298-332
ASQ  HQLPNNTIFCGTPYTKTGGILCVN---.-----NAGSVFHVSPN
DSQ  CACCAACTTCCAAACAATACCATTTTCTGCGGGACACCCTACACGAAGACTGGTGGTATCCTGTGCGTGAAC---------...---------------AACGCGGGCTCCGTGTTCCACGTGTCTCCAAAC
TRN  11011111101111111
NAM  Q8X1X8_PARBR/107-141
ASQ  QQVTSNIVFCGTLYTKTGGLLCVN---.-----NQGSVFHVSPN
DSQ  CAACAGGTGACATCCAATATCGTTTTCTGTGGGACCTTGTACACAAAAACGGGTGGACTGCTTTGTGTCAAC---------...---------------AACCAAGGTTCCGTTTTTCATGTTTCCCCAAAT
TRN  11011101101011011
NAM  CLH_SCHPO/102-133
ASQ  YVMNQDVVYWT-----WISDSVIG---.---MVTDTSVFHWTVS
DSQ  TATGTAATGAATCAAGATGTCGTTTACTGGACT---------------TGGATCAGCGATAGCGTTATCGGT---------...---------ATGGTCACTGACACTTCTGTGTTCCACTGGACCGTCTCC
TRN  11111111111111111
NAM  Q95Z06_9TRYP/103-134
ASQ  VVFNEDVVYWC-----WIDARTVG---.---IVSNTAVYHWSLD
DSQ  GTTGTGTTCAACGAGGACGTGGTCTATTGGTGT---------------TGGATTGATGCTCGCACTGTAGGT---------...---------ATCGTCTCTAATACCGCAGTGTATCACTGGAGTCTGGAC
TRN  11011111101111111
NAM  Q9CA00_ARATH/108-139
ASQ  HQMPEQVVFWK-----WITPKMLG---.---LVTQNSVYHWSIE
DSQ  CATCAGATGCCTGAGCAGGTTGTCTTTTGGAAG---------------TGGATTACACCAAAGATGTTGGGG---------...---------CTGGTCACACAGAATTCCGTCTATCATTGGTCAATTGAA
TRN  11011111101111101
NAM  CLH2_HUMAN/102-133
ASQ  HTMAEEVIFWK-----WVSVNTVA---.---LVTETAVYHWSME
DSQ  CATACTATGGCAGAAGAAGTGATTTTCTGGAAA---------------TGGGTTTCTGTGAACACTGTTGCC---------...---------TTGGTGACCGAGACCGCGGTCTACCACTGGAGCATGGAA
TRN  11111101111011011
NAM  CLH_DROME/102-133
ASQ  HTMNEDVVFWK-----WISLNTLA---.---LVTETSVFHWSME
DSQ  CATACCATGAACGAGGATGTGGTGTTCTGGAAG---------------TGGATCTCCCTTAATACGCTAGCT---------...---------CTGGTCACAGAAACGAGTGTGTTCCATTGGTCCATGGAG
TRN  11011111101111111
NAM  CLH_RAT/102-133
ASQ  HTMTDDVTFWK-----WISLNTVA---.---LVTDNAVYHWSME
DSQ  CACACCATGACCGATGATGTCACCTTCTGGAAA---------------TGGATCTCTCTGAATACGGTTGCT---------...---------CTTGTTACGGATAATGCAGTTTATCACTGGAGCATGGAG
TRN  11011101101011011
NAM  CLH_CAEEL/100-131
ASQ  HQNVEDVVYWK-----WISEKTIA---.---LVSDTAVYHWSIE
DSQ  CATCAGAATGTAGAAGATGTAGTTTATTGGAAG---------------TGGATCAGTGAGAAAACGATTGCA---------...---------CTCGTTTCCGACACAGCCGTCTATCATTGGTCGATCGAG
TRN  11011101111011011
NAM  CLH_DICDI/102-133
ASQ  CQMQEPLEFWK-----WISPNTLA---.---LVTATSVFHWTKE
DSQ  TGTCAAATGCAAGAACCATTAGAATTTTGGAAA---------------TGGATATCACCAAATACATTAGCA---------...---------TTAGTTACAGCAACATCTGTATTTCATTGGACAAAAGAA
TRN  10010101110011000
NAM  Q7SHV2_NEUCR/105-136
ASQ  TNMSEDVLFWK-----WVSETTLG---.---LITDGSVYHWDVF
DSQ  ACAAACATGAGCGAGGATGTCTTGTTCTGGAAG---------------TGGGTTAGCGAGACCACGCTTGGC---------...---------TTGATCACAGATGGCTCTGTTTACCATTGGGATGTCTTC
TRN  11011111111111111
NAM  Q8I5L6_PLAF7/107-138
ASQ  LNLNEYMNYWK-----WINNDTIA---.---IVCEKNVYHWNID
DSQ  CTTAATTTAAATGAGTATATGAATTATTGGAAG---------------TGGATTAATAATGATACCATTGCT---------...---------ATTGTTTGTGAAAAAAATGTATATCACTGGAATATTGAT
TRN  11011101111011010
NAM  Q95Z06_9TRYP/203-234
ASQ  GTFISTNTPTD-----PRSCNLMC---.---LAWNNPSTGGKIL
DSQ  GGAACATTCATTTCCACCAACACCCCGACAGAC---------------CCACGCTCATGCAATTTGATGTGC---------...---------CTCGCTTGGAACAACCCCTCCACAGGTGGGAAAATTTTG
TRN  11011101111011001
NAM  Q8X1X8_PARBR/12-43
ASQ  GTFISTNTPTE-----PRACNIMC---.---LAWNTPHEGGKVQ
DSQ  GGGACATTCATCTCGACAAATACACCCACCGAG---------------CCCCGTGCATGCAACATCATGTGC---------...---------CTGGCGTGGAACACCCCGCACGAAGGTGGCAAAGTGCAG
TRN  11011101101011011
//