EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01321 - Creatinase_N)
FAM  PF01321
PID  Creatinase_N
DES  Creatinase
IPR  IPR000587
ANO  2
ALN  164
AID  0.55
APH  (CREA_BACB0/1-163:0.55868,CREA_FLASU/1-156:0.12200);
ATP  (CREA_BACB0/1-163,CREA_FLASU/1-156);
ATL  0.68068
DNO  2
DLN  492
DID  0.56129
DPH  (CREA_BACB0/1-163:0.00782,CREA_FLASU/1-156:0.65196);
DTP  (CREA_BACB0/1-163,CREA_FLASU/1-156);
DTL  0.65978
RID  0.55
RPH  (CREA_BACB0/1-163:0.61756,CREA_FLASU/1-156:0.06312);
RTP  (CREA_BACB0/1-163,CREA_FLASU/1-156);
RTL  0.68068
LNK  CREA_BACB0/1-163:P38487:D14463
LNK  CREA_FLASU/1-156:P19213:D00656
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  CREA_BACB0/1-163
ASQ  QQITDLERTKILQNGGEKVKPTFSKEEMTRRNTRLREYMAKAGIDAVMFTSYHNINYYSDFLYTSFNRSYALVVTQDKHVTVSANIDAGMPWRRSF-DENIVYTDWKRDNFLYAVKKVLNEGGFSSGRLGVENDHMTLDLRRQVQDALPNTELVDVSQAVMGHR
DSQ  CAACAAATCACAGATCTTGAAAGAACAAAGATTTTACAAAACGGCGGGGAGAAAGTAAAGCCCACTTTTTCAAAAGAGGAAATGACACGCCGCAATACCCGTTTACGCGAGTATATGGCGAAGGCCGGAATCGATGCTGTTATGTTCACTTCTTACCATAATATCAACTATTACAGCGACTTTTTATATACATCATTCAACAGATCGTATGCGCTCGTCGTCACTCAGGACAAGCATGTGACTGTAAGCGCAAACATTGATGCCGGCATGCCGTGGAGACGCAGCTTT---GACGAGAATATTGTTTACACAGACTGGAAAAGAGACAACTTTCTTTATGCCGTGAAAAAGGTATTAAATGAGGGAGGCTTCTCCAGCGGCCGTCTCGGTGTAGAAAATGATCATATGACGCTGGATTTACGGCGCCAAGTGCAGGATGCCCTGCCAAACACAGAGCTTGTGGACGTTTCCCAGGCGGTGATGGGGCATCGG
TRN  10010101100011000
NAM  CREA_FLASU/1-156
ASQ  MQMPKTLR---IRNG-EKVKSTFSAQEYANRHAKLRAHLAAENIDAAVFTSYHNINYYSDFLYCSFGRPYALVVTQDDVISISANIDGGQPWRRTVGTDNIVYTDWQRDNYFVAIQQALPR----ARRIGIEHDHLNLQNRDKLAARYPDAELVDVAAACMRMR
DSQ  ATGCAAATGCCCAAAACACTCCGC---------ATCCGCAACGGT---GAAAAGGTCAAGTCCACCTTCTCCGCGCAGGAATACGCCAACCGCCATGCCAAGCTGCGCGCGCACCTGGCGGCCGAGAACATCGATGCTGCGGTCTTCACCTCGTACCACAACATCAACTACTACTCCGACTTCCTGTACTGCTCCTTCGGTCGTCCCTACGCCCTGGTCGTGACGCAGGACGACGTGATCAGCATCAGCGCCAACATCGACGGTGGCCAGCCGTGGCGCCGCACCGTGGGCACCGACAACATCGTCTACACCGACTGGCAGCGCGACAACTACTTCGTCGCCATCCAGCAGGCGCTGCCCAGG------------GCGCGTCGCATCGGTATCGAGCACGACCACCTGAACCTGCAGAACCGCGACAAGCTGGCCGCCCGCTACCCGGATGCCGAGCTGGTCGACGTGGCCGCCGCCTGCATGCGCATGCGC
TRN  10010101100011011
//