EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01289 - Thiol_cytolysin)
FAM  PF01289
PID  Thiol_cytolysin
DES  Thiol-activated cytolysin
IPR  IPR001869
ANO  6
ALN  468
AID  0.544359
APH  (TACY_STRPY/105-570:0.26535,(TACY_CLOPE/34-499:0.11048,TACY_PAEAL/37-501:0.19939):0.07746,(TACY_STRPN/1-467:0.53118,(TACY_LISIV/56-523:0.10759,TACY_LISMO/57-524:0.10694):0.40789):0.33848);
ATP  (TACY_STRPY/105-570,(TACY_CLOPE/34-499,TACY_PAEAL/37-501),(TACY_STRPN/1-467,(TACY_LISIV/56-523,TACY_LISMO/57-524)));
ATL  2.14476
DNO  6
DLN  1404
DID  0.574906
DPH  (TACY_STRPY/105-570:0.26049,(TACY_CLOPE/34-499:0.16372,TACY_PAEAL/37-501:0.22547):0.09010,(TACY_STRPN/1-467:0.38947,(TACY_LISIV/56-523:0.13693,TACY_LISMO/57-524:0.12659):0.27981):0.17809);
DTP  (TACY_STRPY/105-570,(TACY_CLOPE/34-499,TACY_PAEAL/37-501),(TACY_STRPN/1-467,(TACY_LISIV/56-523,TACY_LISMO/57-524)));
DTL  1.85067
RID  0.544359
RPH  (TACY_STRPY/105-570:0.26535,(TACY_CLOPE/34-499:0.11048,TACY_PAEAL/37-501:0.19939):0.07746,(TACY_STRPN/1-467:0.53118,(TACY_LISIV/56-523:0.10759,TACY_LISMO/57-524:0.10694):0.40789):0.33848);
RTP  (TACY_STRPY/105-570,(TACY_CLOPE/34-499,TACY_PAEAL/37-501),(TACY_STRPN/1-467,(TACY_LISIV/56-523,TACY_LISMO/57-524)));
RTL  2.14476
LNK  TACY_CLOPE/34-499:P19995:AP003185
LNK  TACY_LISIV/56-523:P31831:X60461
LNK  TACY_LISMO/57-524:P13128:X15127
LNK  TACY_PAEAL/37-501:P23564:M62709
LNK  TACY_STRPN/1-467:P11990:AE007483
LNK  TACY_STRPY/105-570:P21131:M18638
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TACY_STRPY/105-570
ASQ  HTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTPVDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGD-KATVEVNDPTYANVSTAIDNLVNQWHDNYSGGN-TLPARTQYTESMVYSKSQIEAALNVNSKILDGTLGIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPLFVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGGDAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVETTSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVIPLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITY
DSQ  CACACTGAAGAAATCAATGACAAGATTTATTCACTAAATTATAATGAGCTTGAAGTACTTGCTAAAAATGGTGAAACCATTGAAAATTTTGTTCCTAAAGAAGGCGTTAAGAAAGCTGATAAATTTATTGTCATTGAAAGAAAGAAAAAAAATATCAACACTACACCAGTCGATATTTCCATCATTGACTCTGTCACTGATAGGACCTATCCAGCAGCCCTTCAGCTGGCTAATAAAGGTTTTACCGAAAACAAACCAGACGCGGTAGTCACCAAGCGAAACCCACAAAAAATCCATATTGATTTACCAGGTATGGGAGAC---AAAGCAACGGTTGAGGTCAATGACCCTACCTATGCCAATGTTTCAACAGCTATTGATAATCTTGTTAACCAATGGCATGATAATTATTCTGGTGGTAAT---ACGCTTCCTGCCAGAACACAATATACTGAATCAATGGTATATTCTAAGTCACAGATTGAAGCAGCTCTAAATGTTAATAGCAAAATCTTAGATGGTACTTTAGGCATTGATTTCAAGTCGATTTCAAAAGGTGAAAAGAAGGTGATGATTGCAGCATACAAGCAAATTTTTTACACCGTATCAGCAAACCTTCCTAATAATCCTGCGGATGTGTTTGATAAATCAGTGACCTTTAAAGAGTTGCAACGAAAAGGTGTCAGCAATGAAGCTCCGCCACTCTTTGTGAGTAACGTAGCCTATGGTCGAACTGTTTTTGTCAAACTAGAAACAAGTTCTAAAAGTAATGATGTTGAAGCGGCCTTTAGTGCAGCTCTAAAAGGAACAGATGTTAAAACTAATGGAAAATACTCTGATATCTTAGAAAATAGCTCATTTACAGCTGTCGTTTTAGGAGGAGATGCTGCAGAGCACAATAAGGTAGTCACAAAAGACTTTGATGTTATTAGAAACGTTATCAAAGACAATGCTACCTTCAGTAGAAAAAACCCAGCTTATCCTATTTCATACACCAGTGTTTTCCTTAAAAATAATAAAATTGCGGGTGTCAATAACAGAACTGAATACGTTGAAACAACATCTACCGAGTACACTAGTGGAAAAATTAACCTGTCTCATCAAGGCGCGTATGTTGCTCAATATGAAATCCTTTGGGATGAAATCAATTATGATGACAAAGGAAAAGAAGTGATTACAAAACGACGTTGGGATAACAACTGGTATAGTAAGACATCACCATTTAGCACAGTTATCCCACTAGGAGCTAATTCACGAAATATACGTATCATGGCTAGAGAGTGCACCGGCTTAGCTTGGGAATGGTGGCGAAAAGTGATCGACGAAAGAGATGTGAAACTGTCTAAAGAAATCAATGTCAACATCTCAGGATCAACCCTGAGCCCATATGGTTCGATTACTTAT
TRN  10010101100011000
NAM  TACY_PAEAL/37-501
ASQ  PND-IDMGIAGLNYNRNEVLAIQGDQISSFVPKEGIQSNGKFIVVERDKKSLTTSPVDISIVDSITNRTYPGAIQLANKDFADNQPSLVMAARKPLDISIDLPGLKN-ENTISVQNPNYGTVSSAIDQLVSTWGEKYSSTH-TLPARLQYAESMVYSQNQISSALNVNAKVLNGTLGIDFNAVANGEKKVMVAAYKQIFYTVSAGLPNNPSDLFDDSVTFAELARKGVSNEAPPLMVSNVAYGRTIYVKLETTSKSNDVQTAFKLLLNNPSIQASGQYKDIYENSSFTAVVLGGDAQTHNQVVTKDFNVIQSVIKDNAQFSSKNPAYPISYTSVFLKDNSIAAVHNNTEYIETKTTEYSKGKIKLDHSGAYVAQFEVYWDEFSYDADGQEIVTRKSWDGNWRDRSAHFSTEIPLPPNAKNIRIFARECTGLAWEWWRTVVDEYNVPLASDINVSIWGTTLYPKSSITH
DSQ  CCCAATGAT---ATTGATATGGGGATCGCAGGACTGAACTATAATCGCAATGAGGTTTTGGCTATTCAAGGGGATCAAATCAGTAGTTTTGTTCCCAAAGAAGGCATTCAGTCCAATGGCAAATTTATCGTGGTTGAACGGGACAAAAAATCACTCACAACGTCACCCGTAGATATTTCCATCGTTGATTCAATCACGAATCGCACGTATCCAGGCGCAATACAGCTTGCAAATAAGGATTTTGCCGATAATCAGCCTAGTCTGGTTATGGCTGCGAGAAAACCATTAGATATTAGCATCGATCTGCCTGGTTTGAAGAAC---GAGAATACAATTTCCGTTCAAAATCCAAATTACGGCACTGTATCTAGTGCCATTGATCAGCTCGTGTCGACTTGGGGCGAGAAGTATTCCAGCACGCAT---ACACTGCCTGCAAGATTACAATACGCTGAATCCATGGTTTACAGCCAAAATCAAATTTCCAGCGCCCTGAATGTGAACGCTAAAGTACTGAACGGTACACTCGGAATCGACTTTAACGCGGTTGCAAATGGCGAGAAAAAAGTGATGGTTGCTGCTTACAAGCAAATCTTTTATACCGTAAGTGCAGGACTGCCCAACAATCCATCAGACTTGTTCGATGACAGTGTGACATTTGCTGAGTTAGCTCGCAAGGGAGTAAGCAATGAGGCACCGCCGCTGATGGTATCTAACGTGGCTTACGGCAGAACTATTTACGTAAAATTGGAAACAACTTCTAAGAGCAATGACGTACAAACGGCATTTAAATTGTTGCTCAATAATCCTAGCATACAAGCTAGCGGACAGTACAAAGATATTTATGAGAACAGCTCGTTTACTGCCGTTGTACTAGGCGGCGACGCGCAAACCCATAACCAAGTCGTTACGAAAGACTTCAATGTTATCCAAAGTGTAATCAAGGACAATGCACAATTTAGCAGCAAGAACCCTGCTTACCCGATTTCATATACAAGTGTCTTCTTGAAAGACAATTCCATTGCTGCTGTTCACAACAATACCGAGTATATCGAGACGAAAACGACGGAATATTCGAAGGGTAAAATTAAGCTTGATCATAGTGGTGCATATGTAGCTCAGTTTGAAGTATATTGGGATGAATTTTCATATGATGCAGATGGACAAGAAATCGTGACTCGTAAAAGTTGGGATGGAAATTGGCGCGATAGATCTGCTCATTTCTCAACAGAAATCCCACTTCCTCCTAATGCCAAGAACATAAGAATTTTTGCGAGAGAATGCACAGGTCTTGCTTGGGAATGGTGGAGAACAGTTGTTGATGAATATAACGTTCCGTTAGCAAGCGATATTAATGTTTCGATTTGGGGAACAACGTTATATCCGAAATCATCCATTACTCAC
TRN  10010101100011000
NAM  TACY_CLOPE/34-499
ASQ  KNQSIDSGISSLSYNRNEVLASNGDKIESFVPKEGKKTGNKFIVVERQKRSLTTSPVDISIIDSVNDRTYPGALQLADKAFVENRPTILMVKRKPININIDLPGLKG-ENSIKVDDPTYGKVSGAIDELVSKWNEKYSSTH-TLPARTQYSESMVYSKSQISSALNVNAKVLENSLGVDFNAVANNEKKVMILAYKQIFYTVSADLPKNPSDLFDDSVTFNDLKQKGVSNEAPPLMVSNVAYGRTIYVKLETTSSSKDVQAAFKALIKNTDIKNSQQYKDIYENSSFTAVVLGGDAQEHNKVVTKDFDEIRKVIKDNATFSTKNPAYPISYTSVFLKDNSVAAVHNKTDYIETTSTEYSKGKINLDHSGAYVAQFEVAWDEVSYDKEGNEVLTHKTWDGNYQDKTAHYSTVIPLEANARNIRIKARECTGLAWEWWRDVISEYDVPLTNNINVSIWGTTLYPGSSITY
DSQ  AAAAATCAAAGTATTGATTCTGGAATATCAAGCTTAAGTTACAATAGAAATGAAGTTTTAGCTAGTAATGGAGATAAAATTGAAAGTTTTGTTCCAAAGGAAGGTAAAAAGACTGGTAATAAATTTATAGTTGTAGAACGTCAAAAAAGATCCCTTACAACATCACCAGTAGATATATCAATAATTGATTCTGTAAATGACCGTACATATCCAGGAGCATTACAACTTGCAGATAAAGCCTTTGTGGAAAATAGACCTACAATCTTAATGGTAAAAAGAAAGCCTATTAACATTAATATAGATTTACCAGGATTAAAGGGT---GAAAATAGTATAAAGGTTGATGATCCAACCTATGGAAAAGTTTCTGGAGCAATTGATGAGTTAGTGTCTAAGTGGAATGAAAAGTATTCATCTACACAT---ACTTTACCAGCAAGAACTCAATATTCAGAATCTATGGTTTATAGTAAATCACAAATATCAAGTGCCCTTAATGTTAATGCTAAAGTCCTTGAAAACTCACTTGGAGTAGACTTTAATGCAGTAGCAAACAATGAGAAAAAAGTTATGATTTTAGCATATAAACAAATATTCTATACAGTAAGTGCAGACTTACCTAAGAATCCATCAGATCTTTTTGATGACAGTGTTACATTTAATGATTTAAAACAAAAGGGAGTAAGTAATGAAGCACCTCCACTTATGGTTTCAAATGTAGCTTATGGAAGAACTATATATGTTAAGTTAGAAACTACTTCTAGTAGTAAAGATGTACAAGCTGCTTTCAAAGCTCTTATAAAGAACACTGATATAAAAAATAGTCAACAATATAAAGATATTTATGAAAATAGTTCCTTCACAGCAGTAGTTTTAGGAGGAGATGCACAAGAACATAACAAAGTTGTAACTAAGGACTTTGATGAAATAAGAAAAGTAATTAAAGACAATGCAACTTTTAGTACAAAAAACCCAGCATATCCAATATCTTATACTAGTGTTTTCTTAAAAGATAACTCAGTTGCTGCTGTTCACAATAAAACAGATTATATAGAAACAACTTCTACAGAGTATTCTAAGGGAAAAATAAACTTAGATCATAGTGGAGCCTATGTTGCACAGTTTGAAGTAGCATGGGATGAAGTTTCATATGACAAAGAAGGAAATGAAGTTTTAACTCATAAAACATGGGATGGAAATTATCAAGATAAAACAGCTCACTATTCAACAGTAATACCTCTTGAAGCCAATGCAAGAAATATAAGAATAAAGGCAAGAGAGTGTACAGGTCTTGCTTGGGAATGGTGGAGAGATGTTATAAGTGAATATGATGTTCCATTAACAAATAATATAAATGTTTCAATATGGGGAACTACTTTATACCCTGGATCTAGTATTACTTAC
TRN  10010101110011000
NAM  TACY_LISMO/57-524
ASQ  HADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKV
DSQ  CACGCGGATGAAATCGATAAGTATATACAAGGATTGGATTACAATAAAAACAATGTATTAGTATACCACGGAGATGCAGTGACAAATGTGCCGCCAAGAAAAGGTTACAAAGATGGAAATGAATATATTGTTGTGGAGAAAAAGAAGAAATCCATCAATCAAAATAATGCAGACATTCAAGTTGTGAATGCAATTTCGAGCCTAACCTATCCAGGTGCTCTCGTAAAAGCGAATTCGGAATTAGTAGAAAATCAACCAGATGTTCTCCCTGTAAAACGTGATTCATTAACACTCAGCATTGATTTGCCAGGTATGACTAATCAAGACAATAAAATCGTTGTAAAAAATGCCACTAAATCAAACGTTAACAACGCAGTAAATACATTAGTGGAAAGATGGAATGAAAAATATGCTCAAGCTTATCCAAATGTAAGTGCAAAAATTGATTATGATGACGAAATGGCTTACAGTGAATCACAATTAATTGCGAAATTTGGTACAGCATTTAAAGCTGTAAATAATAGCTTGAATGTAAACTTCGGCGCAATCAGTGAAGGGAAAATGCAAGAAGAAGTCATTAGTTTTAAACAAATTTACTATAACGTGAATGTTAATGAACCTACAAGACCTTCCAGATTTTTCGGCAAAGCTGTTACTAAAGAGCAGTTGCAAGCGCTTGGAGTGAATGCAGAAAATCCTCCTGCATATATCTCAAGTGTGGCGTATGGCCGTCAAGTTTATTTGAAATTATCAACTAATTCCCATAGTACTAAAGTAAAAGCTGCTTTTGATGCTGCCGTAAGCGGAAAATCTGTCTCAGGTGATGTAGAACTAACAAATATCATCAAAAATTCTTCCTTCAAAGCCGTAATTTACGGAGGTTCCGCAAAAGATGAAGTTCAAATCATCGACGGCAACCTCGGAGACTTACGCGATATTTTGAAAAAAGGCGCTACTTTTAATCGAGAAACACCAGGAGTTCCCATTGCTTATACAACAAACTTCCTAAAAGACAATGAATTAGCTGTTATTAAAAACAACTCAGAATATATTGAAACAACTTCAAAAGCTTATACAGATGGAAAAATTAACATCGATCACTCTGGAGGATACGTTGCTCAATTCAACATTTCTTGGGATGAAGTAAATTATGATCCTGAAGGTAACGAAATTGTTCAACATAAAAACTGGAGCGAAAACAATAAAAGCAAGCTAGCTCATTTCACATCGTCCATCTATTTGCCAGGTAACGCGAGAAATATTAATGTTTACGCTAAAGAATGCACTGGTTTAGCTTGGGAATGGTGGAGAACGGTAATTGATGACCGGAACTTACCACTTGTGAAAAATAGAAATATCTCCATCTGGGGCACCACGCTTTATCCGAAATATAGTAATAAAGTA
TRN  10010101110011000
NAM  TACY_LISIV/56-523
ASQ  NAAQIDQYIQGLDYDKNNILVYDGEAVKNVPPKAGYKEGNQYIVVEKKKKSINQNNADIQVINSLASLTYPGALVKANSELVENQPDVLPVKRDSVTLSIDLPGMVNHDNEIVVQNATKSNINDGVNTLVDRWNNKYSEEYPNISAKIDYDQEMAYSESQLVAKFGAAFKAVNNSLNVNFGAISEGKVQEEVINFKQIYYTVNVNEPTSPSRFFGKSVTKENLQALGVNAENPPAYISSVAYGRDIFVKLSTSSHSTRVKAAFDTAFKGKSVKGDTELENIIQNASFKAVIYGGSAKDEVEIIDGDLSKLRDILKQGANFDKKNPGVPIAYTTNFLKDNQLAVVKNNSEYIETTSKAYSDGKINLDHSGAYVARFNVTWDEVSYDANGNEVVEHKKWSENDKDKLAHFTTSIYLPGNARNINIHAKECTGLAWEWWRTVVDDRNLPLVKNRNVCIWGTTLYPAYSDTV
DSQ  AATGCAGCTCAAATCGATCAATATATACAAGGGCTGGATTATGATAAAAACAATATATTAGTGTACGATGGAGAAGCTGTTAAAAATGTTCCACCAAAAGCAGGATACAAAGAAGGAAATCAATATATTGTAGTGGAGAAAAAGAAAAAATCTATCAATCAAAATAACGCAGATATTCAAGTTATTAACTCGCTTGCAAGCCTTACTTATCCAGGAGCTTTAGTGAAGGCGAATTCAGAGTTAGTCGAAAATCAACCCGATGTCCTCCCTGTGAAACGAGATTCAGTTACACTTAGTATTGATTTGCCTGGAATGGTTAACCATGACAATGAAATAGTCGTTCAAAATGCAACTAAATCCAATATAAATGACGGAGTGAATACTTTAGTAGATCGTTGGAATAATAAATACTCCGAAGAATACCCAAATATTAGTGCGAAAATTGACTATGATCAAGAAATGGCCTATAGCGAATCGCAATTAGTTGCAAAATTTGGTGCAGCATTTAAAGCTGTTAATAATAGTTTGAATGTAAACTTTGGAGCGATTAGTGAAGGTAAGGTGCAAGAAGAAGTTATTAATTTCAAACAAATTTATTATACTGTTAATGTTAATGAACCTACAAGCCCTTCCAGATTCTTTGGTAAAAGTGTTACTAAAGAAAACTTGCAAGCGCTGGGCGTAAATGCGGAAAATCCACCCGCATACATCTCTAGTGTTGCATATGGTCGTGACATTTTCGTGAAATTATCGACTAGTTCACACAGCACCAGAGTGAAGGCTGCATTCGATACTGCATTTAAGGGTAAATCAGTTAAAGGTGATACAGAATTAGAAAATATTATTCAAAATGCTTCATTTAAAGCGGTGATTTATGGTGGTTCAGCCAAAGATGAAGTAGAAATAATTGATGGAGATTTAAGCAAATTACGAGATATTTTAAAACAAGGGGCTAATTTTGATAAGAAAAATCCGGGCGTACCGATTGCGTATACAACTAATTTCTTGAAAGATAATCAGTTAGCAGTTGTTAAAAATAATTCGGAATATATCGAAACAACTTCTAAGGCTTACTCGGATGGAAAAATTAACCTAGATCATTCCGGTGCCTATGTTGCGAGATTCAATGTTACTTGGGATGAAGTTAGCTATGATGCTAATGGAAATGAAGTTGTTGAACATAAAAAATGGTCCGAAAATGATAAAGATAAGTTAGCTCATTTTACGACATCAATCTATTTGCCAGGGAATGCAAGGAATATTAATATTCATGCGAAAGAATGTACTGGCTTGGCTTGGGAATGGTGGAGAACGGTTGTGGATGATAGAAACTTGCCATTAGTAAAAAATAGAAATGTTTGTATCTGGGGAACAACGCTTTATCCAGCGTATAGTGATACTGTA
TRN  10010101100011000
NAM  TACY_STRPN/1-467
ASQ  ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVN-NVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVAPQTEWKQILDNTEVKAVILGGDPSSGARVVTGKVDMVEDLIQEGSRFTADHPGLPISYTTSFLRDNVVATFQNSTDYVETKVTAYRNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKV
DSQ  GCAAATAAAGCAGTAAATGACTTTATACTAGCTATGAATTACGATAAAAAGAAACTCTTGACCCATCAGGGAGAAAGTATTGAAAATCGTTTCATCAAAGAGGGTAATCAGCTACCCGATGAGTTTGTTGTTATCGAAAGAAAGAAGCGGAGCTTGTCGACAAATACAAGTGATATTTCTGTAACAGCTACCAACGACAGTCGCCTCTATCCTGGAGCACTTCTCGTAGTGGATGAGACCTTGTTAGAGAATAATCCCACTCTTCTTGCGGTCGATCGTGCTCCGATGACTTATAGTATTGATTTGCCTGGTTTGGCAAGTAGCGATAGCTTTCTCCAAGTGGAAGACCCCAGCAATTCAAGTGTTCGCGGAGCGGTAAACGATTTGTTGGCTAAGTGGCATCAAGATTATGGTCAGGTCAAT---AATGTCCCAGCTAGAATGCAGTATGAAAAAATCACGGCTCACAGCATGGAACAACTCAAGGTCAAGTTTGGTTCTGACTTTGAAAAGACAGGGAATTCTCTTGATATTGATTTTAACTCTGTCCATTCAGGCGAAAAGCAGATTCAGATTGTTAATTTTAAGCAGATTTATTATACAGTCAGCGTAGATGCTGTTAAAAATCCAGGAGATGTGTTTCAAGATACTGTAACGGTAGAGGATTTAAAACAGAGAGGAATTTCTGCAGAGCGTCCTTTGGTCTATATTTCGAGTGTTGCTTATGGGCGCCAAGTCTATCTCAAGTTGGAAACCACGAGTAAGAGTGATGAAGTAGAGGCTGCTTTTGAAGCTTTGATAAAAGGAGTCAAGGTAGCTCCTCAGACAGAGTGGAAACAGATTTTGGACAATACAGAAGTGAAGGCGGTTATTTTAGGGGGCGACCCAAGTTCGGGTGCCCGAGTTGTAACAGGCAAGGTGGATATGGTAGAGGACTTGATTCAAGAAGGCAGTCGCTTTACAGCAGATCATCCAGGCTTGCCGATTTCCTATACAACTTCTTTTTTACGTGACAATGTAGTTGCGACCTTTCAAAATAGTACAGACTATGTTGAGACTAAGGTTACAGCTTACAGAAACGGAGATTTACTGCTGGATCATAGTGGTGCCTATGTTGCCCAATATTATATTACTTGGAATGAATTATCCTATGATCATCAAGGTAAGGAAGTCTTGACTCCTAAGGCTTGGGACAGAAATGGGCAGGATTTAACGGCTCACTTTACCACTAGTATTCCTTTAAAAGGGAATGTTCGTAATCTCTCTGTCAAAATTAGAGAGTGTACCGGGCTTGCCTGGGAATGGTGGCGTACGGTTTATGAAAAAACCGATTTGCCACTAGTGCGTAAGCGGACGATTTCTATTTGGGGAACAACTCTCTATCCTCAGGTAGAAGATAAGGTA
TRN  10010101100011000
//