EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01253 - SUI1)
FAM  PF01253
PID  SUI1
DES  Translation initiation factor SUI1
IPR  IPR001950
ANO  26
ALN  85
AID  0.346534
APH  (((((((((SUI1_AERPE/19-96:0.27205,(SUI1_PYRHO/18-95:0.16623,((SUI1_METJA/22-99:0.09148,SUI1_METVA/21-98:0.19860):0.24200,SUI1_METTH/20-97:0.24745):0.23278):0.08584):0.10183,SUI1_ARCFU/21-98:0.26917):0.13418,SUI1_HALN1/21-97:0.39514):0.00000,SUI1_THEVO/20-98:0.44284):0.06916,((((YCIH_SALTY/27-105:0.17049,YCIH_HAEIN/25-103:0.13191):0.07012,Q9KM19_VIBCH/22-100:0.20774):0.17027,Q9HUX0_PSEAE/42-120:0.50182):0.22764,Y546_SYNY3/30-108:0.67183):0.52290):0.54911,((((SUI11_ARATH/25-106:0.06288,Q9FFT6_ARATH/24-105:0.18858):0.20713,(SUI1_YEAST/20-101:0.14277,SUI1_SCHPO/21-102:0.17732):0.22007):0.07369,(SUI1_ANOGA/22-103:0.26514,SU13_MOUSE/25-106:0.16199):0.07333):0.12783,Q9NB95_NEOCA/25-106:0.34519):0.14679):0.59645,(Q9C9H2_ARATH/473-556:0.78507,Q9GU72_DROME/463-546:0.96616):0.13724):0.50264,(DENR_SCHPO/93-175:0.32467,Q9P3T4_NEUCR/88-170:0.18983):0.10801):0.31573,DENR_HUMAN/109-187:0.35636,DENR_CAEEL/104-181:0.28522);
ATP  (((((((((SUI1_AERPE/19-96,(SUI1_PYRHO/18-95,((SUI1_METJA/22-99,SUI1_METVA/21-98),SUI1_METTH/20-97))),SUI1_ARCFU/21-98),SUI1_HALN1/21-97),SUI1_THEVO/20-98),((((YCIH_SALTY/27-105,YCIH_HAEIN/25-103),Q9KM19_VIBCH/22-100),Q9HUX0_PSEAE/42-120),Y546_SYNY3/30-108)),((((SUI11_ARATH/25-106,Q9FFT6_ARATH/24-105),(SUI1_YEAST/20-101,SUI1_SCHPO/21-102)),(SUI1_ANOGA/22-103,SU13_MOUSE/25-106)),Q9NB95_NEOCA/25-106)),(Q9C9H2_ARATH/473-556,Q9GU72_DROME/463-546)),(DENR_SCHPO/93-175,Q9P3T4_NEUCR/88-170)),DENR_HUMAN/109-187,DENR_CAEEL/104-181);
ATL  12.946
DNO  24
DLN  255
DID  0.448961
DPH  (((((((((SUI1_HALN1/21-97:0.36292,SUI1_ARCFU/21-98:0.19836):0.11372,((((SUI1_METJA/22-99:0.13489,SUI1_METVA/21-98:0.20419):0.18188,SUI1_METTH/20-97:0.20775):0.12106,SUI1_AERPE/19-96:0.32463):0.09781,SUI1_THEVO/20-98:0.37705):0.03525):0.04271,(((YCIH_SALTY/27-105:0.16038,YCIH_HAEIN/25-103:0.27583):0.15259,Q9KM19_VIBCH/22-100:0.10937):0.29436,(Q9HUX0_PSEAE/42-120:0.30877,Y546_SYNY3/30-108:0.58447):0.14319):0.20979):0.16581,((((SUI11_ARATH/25-106:0.12070,Q9FFT6_ARATH/24-105:0.17281):0.12747,(SUI1_YEAST/20-101:0.23572,SUI1_SCHPO/21-102:0.24284):0.19250):0.14840,SU13_MOUSE/25-106:0.07678):0.10057,SUI1_ANOGA/22-103:0.26639):0.18354):0.11240,Q9GU72_DROME/463-546:0.61405):0.10705,Q9C9H2_ARATH/473-556:0.53695):0.28396,Q9P3T4_NEUCR/88-170:0.26658):0.13986,DENR_SCHPO/93-175:0.27425):0.13522,DENR_HUMAN/109-187:0.37345,DENR_CAEEL/104-181:0.24579);
DTP  (((((((((SUI1_HALN1/21-97,SUI1_ARCFU/21-98),((((SUI1_METJA/22-99,SUI1_METVA/21-98),SUI1_METTH/20-97),SUI1_AERPE/19-96),SUI1_THEVO/20-98)),(((YCIH_SALTY/27-105,YCIH_HAEIN/25-103),Q9KM19_VIBCH/22-100),(Q9HUX0_PSEAE/42-120,Y546_SYNY3/30-108))),((((SUI11_ARATH/25-106,Q9FFT6_ARATH/24-105),(SUI1_YEAST/20-101,SUI1_SCHPO/21-102)),SU13_MOUSE/25-106),SUI1_ANOGA/22-103)),Q9GU72_DROME/463-546),Q9C9H2_ARATH/473-556),Q9P3T4_NEUCR/88-170),DENR_SCHPO/93-175),DENR_HUMAN/109-187,DENR_CAEEL/104-181);
DTL  9.76405
RID  0.342677
RPH  ((((((((((SUI1_METJA/22-99:0.06411,SUI1_METVA/21-98:0.22251):0.20873,SUI1_METTH/20-97:0.28371):0.17023,SUI1_AERPE/19-96:0.31834):0.08566,SUI1_ARCFU/21-98:0.30647):0.06322,(SUI1_HALN1/21-97:0.36176,SUI1_THEVO/20-98:0.40328):0.15844):0.06424,((((YCIH_SALTY/27-105:0.17178,YCIH_HAEIN/25-103:0.12965):0.06978,Q9KM19_VIBCH/22-100:0.20879):0.22230,Q9HUX0_PSEAE/42-120:0.44298):0.21818,Y546_SYNY3/30-108:0.63472):0.51005):0.48948,(SU13_MOUSE/25-106:0.07884,(SUI1_ANOGA/22-103:0.26634,((SUI11_ARATH/25-106:0.06360,Q9FFT6_ARATH/24-105:0.18665):0.19444,(SUI1_YEAST/20-101:0.13314,SUI1_SCHPO/21-102:0.18379):0.23943):0.14158):0.07454):0.31127):0.51038,(Q9C9H2_ARATH/473-556:0.79352,Q9GU72_DROME/463-546:0.98462):0.10537):0.50703,(DENR_SCHPO/93-175:0.32161,Q9P3T4_NEUCR/88-170:0.19302):0.11750):0.29999,DENR_HUMAN/109-187:0.36230,DENR_CAEEL/104-181:0.27768);
RTP  ((((((((((SUI1_METJA/22-99,SUI1_METVA/21-98),SUI1_METTH/20-97),SUI1_AERPE/19-96),SUI1_ARCFU/21-98),(SUI1_HALN1/21-97,SUI1_THEVO/20-98)),((((YCIH_SALTY/27-105,YCIH_HAEIN/25-103),Q9KM19_VIBCH/22-100),Q9HUX0_PSEAE/42-120),Y546_SYNY3/30-108)),(SU13_MOUSE/25-106,(SUI1_ANOGA/22-103,((SUI11_ARATH/25-106,Q9FFT6_ARATH/24-105),(SUI1_YEAST/20-101,SUI1_SCHPO/21-102))))),(Q9C9H2_ARATH/473-556,Q9GU72_DROME/463-546)),(DENR_SCHPO/93-175,Q9P3T4_NEUCR/88-170)),DENR_HUMAN/109-187,DENR_CAEEL/104-181);
RTL  12.2497
LNK  DENR_CAEEL/104-181:Q9NAH4:AL117202
LNK  DENR_HUMAN/109-187:O43583:AB014731
LNK  DENR_SCHPO/93-175:O42929:AL021767
LNK  Q9C9H2_ARATH/473-556:Q9C9H2:AC016163
LNK  Q9FFT6_ARATH/24-105:Q9FFT6:AB005232
LNK  Q9GU72_DROME/463-546:Q9GU72:AF186594
LNK  Q9HUX0_PSEAE/42-120:Q9HUX0:AE004897
LNK  Q9KM19_VIBCH/22-100:Q9KM19:AE004388
LNK  Q9NB95_NEOCA/25-106:Q9NB95:
LNK  Q9P3T4_NEUCR/88-170:Q9P3T4:AL389890
LNK  SU13_MOUSE/25-106:Q9CXU9:AK005192
LNK  SUI11_ARATH/25-106:P41568:U81042
LNK  SUI1_AERPE/19-96:Q9YBG9:AP000062
LNK  SUI1_ANOGA/22-103:P42678:U02588
LNK  SUI1_ARCFU/21-98:O29348:AE001040
LNK  SUI1_HALN1/21-97:Q9HME3:AE005132
LNK  SUI1_METJA/22-99:Q57902:U67497
LNK  SUI1_METTH/20-97:O26118:AE000795
LNK  SUI1_METVA/21-98:P14021:X16720
LNK  SUI1_PYRHO/18-95:P58193:
LNK  SUI1_SCHPO/21-102:P79060:AL035065
LNK  SUI1_THEVO/20-98:Q97BW9:AP000992
LNK  SUI1_YEAST/20-101:P32911:M77514
LNK  Y546_SYNY3/30-108:Q55397:D64003
LNK  YCIH_HAEIN/25-103:P45116:U32802
LNK  YCIH_SALTY/27-105:P20770:X05382
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9NB95_NEOCA/25-106
ASQ  GSTTHLIHIRNQ-QRNGRK.VTTVQGL-DKALDLKKMVRALKKELNCNGTVIEDA-EHGSVIQLQGDQRHAVKEFLEREDICSGE
NAM  SU13_MOUSE/25-106
ASQ  AGTEDYIHIRIQ-QRNGRKtLTTVQGI-ADDYDKKKLVKAFKKKFACNGTVIEHP-EYGEVIQLQGDQRKNICQFLLEVGIVKEE
DSQ  GCAGGGACTGAGGACTACATTCATATAAGGATCCAG---CAGCGCAACGGCAGGAAGacgCTGACCACTGTGCAGGGCATT---GCGGACGATTATGACAAAAAGAAACTTGTGAAAGCTTTCAAAAAGAAATTTGCCTGCAATGGAACTGTGATTGAACACCCT---GAGTACGGAGAGGTTATTCAGCTTCAAGGGGACCAAAGGAAGAACATCTGCCAGTTTCTTCTGGAGGTTGGCATCGTCAAGGAGGAG
TRN  10010101100011011
NAM  SUI1_ANOGA/22-103
ASQ  DVQDGLVHIRIQ-QRNGRKtLTTVQGL-SAEYDLKKIVRACKKEFACNGTVIEHP-EYGEVLQLQGDQRENICQWLTKSGLAKPE
DSQ  GATGTGCAGGACGGTCTCGTGCACATAAGAATTCAG---CAGAGAAATGGTCGCAAAacgCTAACCACTGTCCAGGGATTG---TCGGCCGAGTACGACCTGAAGAAGATCGTGCGAGCATGTAAGAAGGAATTCGCATGCAATGGCACAGTAATTGAGCATCCT---GAGTACGGCGAGGTACTACAGCTGCAGGGTGACCAGCGGGAGAACATTTGCCAGTGGTTAACCAAGTCCGGTCTCGCGAAGCCGGAA
TRN  10010101100011010
NAM  SUI1_SCHPO/21-102
ASQ  AQPLNNIHIRIQ-QRNGRKtLTTVQGL-PREFDQKRILRALKKDFACNGTIVKDD-DLGEVIQLQGDQRIKVMEFLTQQLGLQKK
DSQ  GCTCAGCCTCTGAATAACATTCATATTCGCATCCAG---CAAAGAAATGGCCGAAAGactTTAACTACTGTTCAAGGTCTT---CCTCGTGAATTTGACCAAAAGCGTATCTTGCGTGCTTTGAAAAAAGATTTTGCTTGCAACGGTACCATTGTTAAGGACGAT---GATTTGGGAGAAGTTATACAACTTCAAGGTGATCAACGTATCAAGGTAATGGAGTTTTTGACTCAACAGCTTGGTTTGCAAAAGAAG
TRN  10010101100011010
NAM  SUI1_YEAST/20-101
ASQ  TATSNYIHIRIQ-QRNGRKtLTTVQGV-PEEYDLKRILKVLKKDFACNGNIVKDP-EMGEIIQLQGDQRAKVCEFMISQLGLQKK
DSQ  ACCGCCACTTCAAACTATATTCATATTCGTATCCAA---CAGAGAAATGGTAGAAAAactTTAACTACGGTGCAAGGTGTC---CCAGAGGAATATGATTTAAAGAGAATTCTTAAGGTCCTAAAGAAGGACTTTGCATGTAATGGTAACATTGTCAAGGATCCA---GAAATGGGGGAGATTATTCAGTTGCAGGGTGACCAAAGAGCAAAGGTTTGCGAATTTATGATCTCCCAACTGGGATTGCAAAAGAAG
TRN  10010101100011000
NAM  Q9FFT6_ARATH/24-105
ASQ  PGAKENIHIRIQ-QRNGKKsLTTVQGL-KKEYSYERILKDLKKDFCCNGNVVQDK-ELGKIIQLQGDQRKKVSQFLVQTGIAKKD
DSQ  CCAGGAGCTAAAGAGAACATTCACATTCGAATCCAG---CAGAGGAATGGGAAAAAGagcTTGACGACTGTTCAAGGGCTT---AAGAAAGAGTACAGCTACGAGAGGATTCTCAAGGATTTGAAGAAAGATTTCTGCTGCAACGGTAACGTTGTGCAGGACAAA---GAACTAGGCAAGATCATCCAGCTTCAAGGTGATCAAAGGAAGAAAGTGTCTCAGTTCTTGGTCCAAACTGGGATTGCTAAGAAGGAT
TRN  10010101110011011
NAM  SUI11_ARATH/25-106
ASQ  AGTKEYVHIRVQ-QRNGRKsLTTVQGL-KKEYSYTKILKDLKKEFCCNGTVVQDS-ELGQVIQLQGDQRKNVSTFLVQAGLVKKD
DSQ  GCAGGAACAAAGGAGTACGTTCATATTCGTGTCCAG---CAGCGGAATGGTAGGAAAagcTTGACAACGGTCCAGGGGCTG---AAGAAAGAGTACAGCTACACCAAGATACTTAAGGACCTCAAGAAAGAATTTTGCTGCAACGGAACTGTGGTTCAAGACTCA---GAACTCGGACAGGTTATTCAGCTTCAAGGCGATCAGAGGAAGAACGTCTCCACGTTCCTAGTCCAGGCTGGGCTTGTGAAGAAAGAT
TRN  10010101100011001
NAM  SUI1_AERPE/19-96
ASQ  SVEEQIIKIRLE-KRRFGReVTIIEGINEKEFNLKKLASTLKSRLATGGTA-----KNGR-IELQGDHRHRVKKILVELGFPEEN
DSQ  TCTGTGGAAGAGCAGATAATAAAGATAAGGCTTGAG---AAGAGAAGGTTCGGTAGGgagGTAACCATCATAGAAGGAATTAACGAGAAGGAGTTCAACCTGAAAAAACTGGCTTCCACTCTCAAGAGCAGGCTCGCCACAGGAGGAACAGCA---------------AAGAACGGGCGT---ATAGAGCTTCAGGGCGACCATAGACACAGGGTTAAGAAGATACTGGTCGAGCTGGGGTTCCCCGAGGAGAAC
TRN  10010101100011011
NAM  SUI1_PYRHO/18-95
ASQ  LKEQQRIKVYIE-RARYGKvKTIIEGIDEKEFDLEEIAKKLKAKLACGGTA-----KNGR-IELQGDHRDRIKKLLAELGFSEEL
NAM  SUI1_ARCFU/21-98
ASQ  AKEQQFIVIKTG-KRRYGKeVTIIEGIDKGEINLEELAKYLKSKLACGGTV-----KNGV-IELQGNHVNRVKELLIKKGFNPER
DSQ  GCGAAAGAGCAGCAGTTTATAGTGATTAAAACTGGC---AAGAGACGCTACGGGAAGgaaGTGACCATTATCGAGGGAATTGATAAGGGAGAGATAAACCTTGAGGAACTTGCGAAATACCTGAAGTCAAAGCTGGCGTGCGGTGGGACGGTA---------------AAGAACGGAGTG---ATAGAGCTTCAGGGCAATCACGTGAACAGGGTTAAGGAACTGCTTATAAAGAAGGGATTCAATCCTGAGAGG
TRN  10010101100011001
NAM  SUI1_THEVO/20-98
ASQ  GREAQAVKIVVD-KRRYGKfVTIIEGIDPKIEDIEKIAKELKKKVASGGTV-----KEGRIIELQGDHRQEVKKFLEDMGFKVSV
DSQ  GGAAGAGAGGCCCAGGCTGTGAAAATAGTCGTGGAT---AAGAGGAGATACGGCAAGtttGTTACAATAATTGAGGGAATAGATCCGAAGATAGAGGACATCGAGAAAATCGCAAAAGAATTGAAGAAAAAAGTCGCTTCAGGCGGCACCGTG---------------AAGGAAGGAAGAATAATAGAATTACAAGGAGACCACAGGCAAGAGGTAAAAAAGTTTCTTGAAGATATGGGATTTAAGGTGAGCGTG
TRN  10010101110011000
NAM  SUI1_HALN1/21-97
ASQ  AKESQQIEIRID-ERRYGKeVTVIEGFDPKDVDLDSLSSDLKSKFACGGTV-----EDGE-IELQGNHSGRVEDFLRNKGFNVA-
DSQ  GCCAAAGAGTCCCAGCAAATCGAAATCCGCATCGAC---GAGCGCCGCTACGGGAAAgaaGTTACCGTTATCGAAGGATTCGACCCGAAGGATGTCGACCTCGACAGCCTGTCCTCGGACCTCAAATCGAAGTTCGCGTGCGGGGGGACCGTC---------------GAGGACGGCGAA---ATCGAGTTGCAGGGCAACCACTCGGGTCGCGTGGAGGATTTCCTCCGAAACAAGGGCTTTAACGTCGCC---
TRN  11011101101011011
NAM  SUI1_METTH/20-97
ASQ  AREVQTLKVYTV-RRRFGKvMTIIEGIDEHDIDIKELTKILKARCACGGTA-----KKGQ-IELQGDHKKKVKEVLADMGFSSDT
DSQ  GCACGCGAAGTTCAGACACTAAAGGTCTACACAGTG---AGGCGAAGATTCGGTAAAgtgATGACCATCATTGAGGGCATCGATGAACACGATATAGACATAAAGGAGCTCACTAAGATACTGAAGGCAAGATGTGCCTGTGGAGGCACAGCC---------------AAGAAAGGCCAG---ATAGAACTTCAGGGGGATCATAAGAAGAAGGTCAAGGAAGTTCTGGCAGATATGGGCTTTTCATCAGATACG
TRN  10010101100011001
NAM  SUI1_METVA/21-98
ASQ  AKEEQKIKVYVT-KRRFGKlMTVVDGFDADLIDVKDLAKKLKDICACGGTV-----KKDS-IELQGDHRKKAEEILIKMGFSKDM
DSQ  GCAAAAGAAGAACAAAAAATTAAAGTTTACGTGACT---AAAAGAAGGTTTGGTAAGctaATGACAGTTGTCGATGGCTTTGATGCTGACTTGATTGATGTAAAAGATTTAGCTAAAAAGTTAAAAGATATATGTGCTTGTGGCGGAACCGTA---------------AAGAAAGATTCA---ATCGAATTACAAGGGGACCACAGGAAAAAAGCTGAAGAAATCCTGATAAAAATGGGTTTCTCAAAAGACATG
TRN  10010101100011000
NAM  SUI1_METJA/22-99
ASQ  AKEEQKIKIYVT-KRRFGKlMTIIEGFDTSVIDLKELAKKLKDICACGGTV-----KDNT-IELQGDHRKKVAEELVKMGFSRDS
DSQ  GCTAAAGAAGAACAGAAAATAAAAATATATGTTACA---AAAAGAAGATTTGGTAAGttaATGACTATAATTGAAGGTTTTGATACAAGCGTTATTGATTTAAAAGAACTTGCTAAAAAATTGAAAGATATTTGTGCCTGTGGAGGGACTGTT---------------AAAGATAATACA---ATAGAACTTCAGGGAGACCATAGGAAGAAAGTTGCTGAGGAACTTGTTAAAATGGGTTTCTCAAGAGATTCA
TRN  10010101110011000
NAM  Y546_SYNY3/30-108
ASQ  PPQQQNVRIQATRSGRKGKtVTVVSGLQLSAMGQQALLKALKSFCGSGGTL-----KEDC-VEIQGDQREKILAYLLKQGYKAKI
DSQ  CCCCCCCAACAGCAAAATGTCCGCATCCAAGCAACTCGTTCTGGCCGCAAAGGAAAAacgGTGACGGTAGTGAGTGGTTTGCAATTATCGGCCATGGGACAGCAAGCTCTACTCAAGGCCCTGAAAAGTTTTTGTGGCAGTGGGGGCACCTTG---------------AAAGAAGACTGC---GTGGAAATCCAGGGGGATCAACGGGAGAAAATTCTTGCTTATTTGTTAAAGCAGGGCTACAAGGCTAAAATT
TRN  11011101101011010
NAM  Q9HUX0_PSEAE/42-120
ASQ  PVGDGIARVRRETKGRGGKtVTTISGLSLAGDALKELASALKRRCGTGGSL-----KDGV-VEIQGEHVELLIDELLKRGFKAKK
DSQ  CCTGTCGGCGACGGGATCGCGCGCGTGCGCCGCGAGACCAAGGGCCGCGGCGGCAAGacgGTGACCACCATCAGTGGCCTGTCGCTCGCCGGCGATGCGCTCAAGGAGCTGGCCAGCGCGCTGAAGCGGCGCTGCGGCACCGGCGGCAGTCTC---------------AAGGACGGCGTG---GTGGAGATCCAGGGCGAGCATGTCGAACTGCTGATCGACGAACTCCTCAAGCGCGGTTTCAAGGCGAAGAAG
TRN  11011111101111111
NAM  Q9KM19_VIBCH/22-100
ASQ  PKGDGIVRIFRETKGRKGKgVTIVKGLDLDDAALKLLAAELKKKCGCGGAV-----KDGD-IEIQGDVRDQLKTLLESKGHKVKL
DSQ  CCAAAAGGCGATGGTATTGTCCGCATTTTCCGTGAAACTAAAGGCCGTAAAGGAAAAggtGTCACTATTGTAAAAGGTTTAGACCTTGACGATGCCGCTCTAAAGCTGCTTGCCGCTGAACTCAAGAAAAAATGTGGATGTGGTGGAGCTGTA---------------AAAGATGGCGAT---ATTGAAATTCAAGGAGATGTTAGAGATCAACTCAAAACATTGCTTGAATCGAAAGGACACAAAGTCAAATTA
TRN  10010101100011010
NAM  YCIH_HAEIN/25-103
ASQ  PKGDGVVRIQKQTSGRKGAgVSVITGLDLSDEELKKLAAELKKRCGCGGAV-----KNGI-IEIQGEKRDLLKQLLEQKGFKVKL
DSQ  CCAAAAGGAGACGGTGTTGTACGTATTCAAAAACAAACGAGTGGTAGAAAAGGTGCTggtGTATCAGTTATAACTGGTTTAGATTTATCTGATGAGGAATTGAAAAAATTAGCTGCTGAATTAAAAAAACGTTGTGGATGTGGTGGAGCAGTT---------------AAAAATGGTATT---ATTGAAATTCAAGGGGAAAAACGAGATTTGCTCAAGCAATTATTAGAGCAAAAAGGGTTTAAAGTTAAATTA
TRN  10010101110011000
NAM  YCIH_SALTY/27-105
ASQ  PKGDGIVRIQRQTSGRKGKgVCLITGIEMNDAELTKLAAELKKKCGCGGAV-----KEGI-IEIQGDKRDLIKSLLEAKGMKVKL
DSQ  CCCAAAGGGGATGGTATCGTTCGCATTCAGCGTCAAACCAGTGGCCGTAAGGGTAAAggcGTATGTTTGATTACCGGTATCGAGATGAATGATGCGGAATTAACCAAACTGGCGGCTGAACTGAAGAAAAAATGCGGCTGTGGCGGGGCAGTA---------------AAAGAAGGGATT---ATTGAAATTCAGGGTGATAAACGCGACTTGATAAAATCATTGCTGGAAGCTAAAGGAATGAAAGTAAAATTA
TRN  10010101100011000
NAM  Q9GU72_DROME/463-546
ASQ  TSGKPLIQMSLA-TRSGNKkVTLVSNIEAYGIILAEFIKLCKQGAAASTSVVKLPHQKHEQLQIQGNQVRFVHTLLTETYKVPPK
DSQ  ACGAGCGGGAAGCCCCTCATCCAGATGTCCCTGGCC---ACGCGATCGGGCAACAAGaagGTGACGCTGGTCAGCAACATCGAGGCGTACGGCATCATCCTGGCCGAGTTCATCAAGCTGTGCAAGCAGGGAGCCGCCGCCAGCACCAGTGTGGTGAAACTGCCGCACCAAAAGCACGAGCAGCTGCAAATCCAGGGCAACCAGGTGCGATTTGTGCACACGCTGCTCACGGAAACGTACAAGGTGCCGCCCAAG
TRN  11011101101011011
NAM  Q9C9H2_ARATH/473-556
ASQ  KGAVKPVQIMTE-RRQGNKkVTKVTGMETFLIDPDSFGSELQKKFACSTSVGELPGKKGYEVLIQGGVIDNLARYMVEHYGVPKR
DSQ  AAAGGAGCTGTAAAGCCGGTTCAGATAATGACAGAA---CGAAGACAAGGTAACAAAaaaGTGACCAAGGTCACAGGGATGGAGACGTTCTTGATAGACCCAGACTCGTTTGGATCAGAACTGCAGAAGAAGTTTGCTTGCAGTACTTCAGTTGGAGAACTTCCAGGTAAGAAAGGGTACGAGGTTCTGATTCAAGGAGGTGTGATTGATAACCTTGCGAGATATATGGTGGAACACTATGGAGTTCCAAAGAGA
TRN  10010101100011001
NAM  Q9P3T4_NEUCR/88-170
ASQ  KRANSVVTIKRI-ERNKRKyVTSVSGLEAFGLELKKVAKDFGKKFATGSSVTKVP-SGGEEIVVQGDVSGEIEEFILEKYKEVPE
DSQ  AAGCGCGCCAACAGCGTAGTGACCATCAAGCGCATT---GAGCGCAACAAGAGGAAAtacGTCACTTCGGTGTCGGGCTTGGAGGCGTTTGGGTTGGAGTTAAAGAAGGTTGCCAAGGACTTTGGCAAGAAGTTCGCTACCGGCTCTTCGGTAACCAAGGTACCC---AGCGGCGGCGAGGAGATTGTCGTCCAGGGCGATGTCAGCGGCGAGATTGAGGAGTTCATCCTCGAAAAGTACAAGGAGGTTCCCGAA
TRN  10010101110011010
NAM  DENR_SCHPO/93-175
ASQ  KRMASKVLIKTI-ERTKRKrVTTVQGLDAFGIETKKAAKMLANKFATGASVTKTA-DKKDEIVVQGDLNYDIFDFILEKFKEVPE
DSQ  AAACGTATGGCATCCAAGGTTTTGATAAAAACCATT---GAAAGAACTAAAAGAAAGagaGTCACCACAGTTCAAGGTCTTGACGCATTTGGGATCGAAACGAAAAAAGCTGCTAAGATGTTGGCCAACAAGTTCGCGACCGGAGCCAGTGTCACTAAAACAGCT---GATAAGAAGGATGAAATTGTTGTACAGGGTGATTTGAATTATGATATATTTGATTTTATTTTGGAAAAGTTTAAAGAGGTTCCGGAA
TRN  10010101110011011
NAM  DENR_CAEEL/104-181
ASQ  GGGPQKVTLQR--EPRGKKsVTVIKGLATFDIDLKVASKLFAQKFACGSSV-----TGADEIVIQGDVKDDLLDLIPEKWKQVTD
DSQ  GGCGGTGGACCACAGAAAGTGACGTTGCAACGG------GAGCCACGTGGAAAGAAGagtGTCACTGTTATTAAGGGTCTCGCCACTTTTGACATCGATCTAAAAGTGGCTTCAAAGCTGTTCGCCCAGAAATTCGCGTGCGGCTCGTCAGTC---------------ACCGGAGCCGATGAGATTGTGATTCAGGGAGATGTGAAGGATGATCTTTTGGATTTGATTCCCGAGAAATGGAAGCAAGTGACCGAT
TRN  11011101101011001
NAM  DENR_HUMAN/109-187
ASQ  KTVPQKVTIAKI-PRAKKKyVTRVCGLATFEIDLKEAQRFFAQKFSCGASV-----TGEDEIIIQGDFTDDIIDVIQEKWPEVDD
DSQ  AAGACCGTACCACAAAAGGTTACTATAGCCAAAATT---CCCAGAGCAAAGAAGAAAtatGTGACAAGAGTATGTGGCCTTGCAACTTTTGAAATTGATCTTAAAGAAGCACAAAGATTTTTTGCTCAAAAATTCTCCTGTGGTGCCTCAGTA---------------ACAGGGGAGGATGAAATTATCATTCAGGGAGATTTTACAGATGACATAATTGATGTCATTCAGGAAAAATGGCCAGAGGTAGATGAT
TRN  10010101110011001
//