EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01206 - SirA)
FAM  PF01206
PID  SirA
DES  SirA-like protein
IPR  IPR001455
ANO  8
ALN  75
AID  0.306834
APH  (YRKF_BACSU/4-75:0.26195,((((YEED_ECOLI/3-74:0.72869,Y242_HAEIN/1-72:0.94856):0.24741,Y990_METJA/4-75:0.42444):0.31201,YEDF_ECOLI/6-77:0.50836):0.46224,(SIRA_HAEIN/6-77:0.29205,SIRA_ECOLI/6-79:0.27760):0.64559):0.43256,YRKI_BACSU/3-74:0.33225);
ATP  (YRKF_BACSU/4-75,((((YEED_ECOLI/3-74,Y242_HAEIN/1-72),Y990_METJA/4-75),YEDF_ECOLI/6-77),(SIRA_HAEIN/6-77,SIRA_ECOLI/6-79)),YRKI_BACSU/3-74);
ATL  5.87371
DNO  7
DLN  225
DID  0.433347
DPH  (YRKF_BACSU/4-75:0.25749,((YEDF_ECOLI/6-77:0.44742,SIRA_ECOLI/6-79:0.54392):0.18810,(Y990_METJA/4-75:0.27499,(YEED_ECOLI/3-74:0.46086,Y242_HAEIN/1-72:0.61700):0.12267):0.23061):0.27000,YRKI_BACSU/3-74:0.28060);
DTP  (YRKF_BACSU/4-75,((YEDF_ECOLI/6-77,SIRA_ECOLI/6-79),(Y990_METJA/4-75,(YEED_ECOLI/3-74,Y242_HAEIN/1-72))),YRKI_BACSU/3-74);
DTL  3.69366
RID  0.304166
RPH  (YRKF_BACSU/4-75:0.24887,((YEDF_ECOLI/6-77:0.52000,(Y990_METJA/4-75:0.46664,(YEED_ECOLI/3-74:0.72528,Y242_HAEIN/1-72:0.97323):0.21933):0.29625):0.49402,SIRA_ECOLI/6-79:0.85487):0.39491,YRKI_BACSU/3-74:0.35264);
RTP  (YRKF_BACSU/4-75,((YEDF_ECOLI/6-77,(Y990_METJA/4-75,(YEED_ECOLI/3-74,Y242_HAEIN/1-72))),SIRA_ECOLI/6-79),YRKI_BACSU/3-74);
RTL  5.62129
LNK  SIRA_ECOLI/6-79:P37618:U00039
LNK  SIRA_HAEIN/6-77:P44841:
LNK  Y242_HAEIN/1-72:P44593:U32710
LNK  Y990_METJA/4-75:Q58397:U67541
LNK  YEDF_ECOLI/6-77:P31065:L13279
LNK  YEED_ECOLI/3-74:P33014:U00009
LNK  YRKF_BACSU/4-75:P54433:D84432
LNK  YRKI_BACSU/3-74:P54436:D84432
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YRKI_BACSU/3-74
ASQ  SD--KVLDAKGLACPMPIVRTKKAMNELESGQILEVHATDKGAKNDLTAWSKSGGHDLLEQTDEGDI-LKFWIQK
DSQ  TCAGAT------AAAGTATTAGACGCAAAAGGCTTGGCATGCCCAATGCCAATTGTCAGAACAAAAAAAGCGATGAATGAACTGGAATCAGGTCAAATATTAGAAGTGCATGCAACAGATAAGGGAGCCAAAAATGATCTTACAGCCTGGTCTAAATCAGGCGGACATGACCTTTTAGAGCAAACGGACGAGGGCGATATA---TTGAAATTTTGGATTCAAAAA
TRN  10010101100011000
NAM  YRKF_BACSU/4-75
ASQ  AT--IVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIHATDKGSTADLEAWAKSTGHEYLGTEAEGEI-LRHFLRK
DSQ  GCAACT------ATTGTACTAGACGCTAAAGGTTTGGCGTGTCCAATGCCTATCGTAAAAACGAAGAAGAGAATGAAGGATTTAAAAGCTGGTGAAGTATTGGAAATTCATGCGACAGATAAAGGTTCTACAGCAGATCTGGAAGCATGGGCAAAAAGTACAGGCCATGAATATCTGGGTACTGAAGCAGAGGGAGAAATA---CTTCGTCATTTTCTTCGAAAA
TRN  10010101100011010
NAM  YEDF_ECOLI/6-77
ASQ  PD--YRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQDGPT-IRYLIQK
DSQ  CCTGAT------TACCGCCTTGATATGGTGGGTGAACCCTGCCCTTATCCGGCAGTCGCAACCCTTGAGGCGATGCCGCAGTTAAAAAAAGGGGAAATCCTGGAAGTGGTGAGCGACTGTCCGCAGTCGATCAATAATATTCCACTGGATGCGCGTAATCACGGCTATACGGTGCTGGATATTCAGCAAGACGGGCCGACC---ATTCGTTATTTAATTCAGAAG
TRN  11011101101011010
NAM  Y990_METJA/4-75
ASQ  AM--KKLDVTGDICPVPVLKTKKALEELNEGEELEVVGDYKPALENIKRFAENNGYTVVLAEETESR-FRIVIKK
DSQ  GCTATG------AAAAAACTTGATGTTACTGGAGACATCTGCCCAGTTCCAGTTTTAAAGACAAAAAAGGCTTTAGAAGAATTGAATGAAGGAGAAGAGTTAGAGGTTGTAGGGGACTACAAACCAGCATTAGAAAACATAAAAAGATTTGCTGAAAATAACGGCTATACAGTTGTTTTAGCTGAAGAAACAGAGAGTAGA---TTTAGAATAGTCATCAAAAAA
TRN  10010101110011010
NAM  SIRA_HAEIN/6-77
ASQ  VT--QTLDTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHTLLQCEVEKPP-FKYWVKR
NAM  SIRA_ECOLI/6-79
ASQ  SSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLP-YRYLIRK
DSQ  TCCAGCCCTGACCACACACTCGACGCGCTTGGCCTGCGCTGCCCGGAACCGGTGATGATGGTGCGCAAAACCGTGCGCAATATGCAGCCTGGCGAAACGTTGCTGATTATCGCCGACGATCCGGCCACTACCCGCGATATTCCTGGGTTTTGTACCTTTATGGAACACGAACTGGTTGCTAAAGAGACGGATGGACTGCCT---TATCGTTATTTGATTCGTAAA
TRN  11011101101011011
NAM  YEED_ECOLI/3-74
ASQ  IK---KLDVVTQVCPFPLIEAKAALAEMVSGDELVIEFDCTQATEAIPQWAAEEGHAITDYQQIGDAAWSITVQK
DSQ  ATTAAA---------AAGCTGGATGTGGTGACGCAGGTCTGTCCGTTTCCACTCATAGAAGCAAAAGCAGCTCTGGCAGAAATGGTCAGCGGCGATGAGTTAGTGATTGAGTTTGATTGCACCCAGGCAACTGAAGCAATCCCACAGTGGGCGGCAGAAGAAGGACATGCCATCACCGATTATCAGCAGATTGGCGATGCAGCGTGGAGCATCACCGTTCAAAAA
TRN  10010101100011010
NAM  Y242_HAEIN/1-72
ASQ  MK--YQLNLTALRCPIPLLSAKKALKNLDKNDELMLILNLESAVENFSIFAEENSVALVEQYYASEK-EFIVILK
DSQ  ATGAAA------TATCAGCTCAATTTAACCGCACTTCGATGCCCCATTCCTCTTTTAAGTGCTAAAAAAGCCTTAAAAAATTTGGATAAAAATGATGAGCTAATGTTGATCTTAAACCTTGAAAGTGCGGTGGAAAATTTTTCTATTTTTGCCGAAGAAAATTCTGTTGCTTTGGTCGAGCAATATTACGCTTCGGAAAAA---GAATTTATCGTTATCTTGAAA
TRN  11011101111011010
//