EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01182 - Glucosamine_iso)
FAM  PF01182
PID  Glucosamine_iso
DES  Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
IPR  IPR006148
ANO  4
ALN  238
AID  0.603106
APH  ((NAGB_HAEIN/15-250:0.14206,NAGB_ECOLI/15-250:0.14504):0.09967,NAG1_CANAL/15-247:0.56376,GNPI_HUMAN/15-250:0.32042);
ATP  ((NAGB_HAEIN/15-250,NAGB_ECOLI/15-250),NAG1_CANAL/15-247,GNPI_HUMAN/15-250);
ATL  1.27095
DNO  4
DLN  714
DID  0.583395
DPH  ((NAGB_HAEIN/15-250:5.86701,NAGB_ECOLI/15-250:6.61788):6.77785,NAG1_CANAL/15-247:20.67315,GNPI_HUMAN/15-250:12.55592);
DTP  ((NAGB_HAEIN/15-250,NAGB_ECOLI/15-250),NAG1_CANAL/15-247,GNPI_HUMAN/15-250);
DTL  52.5397
RID  0.603106
RPH  ((NAGB_HAEIN/15-250:0.14206,NAGB_ECOLI/15-250:0.14504):0.09967,NAG1_CANAL/15-247:0.56376,GNPI_HUMAN/15-250:0.32042);
RTP  ((NAGB_HAEIN/15-250,NAGB_ECOLI/15-250),NAG1_CANAL/15-247,GNPI_HUMAN/15-250);
RTL  1.27095
LNK  GNPI_HUMAN/15-250:P46926:AF048826
LNK  NAG1_CANAL/15-247:Q04802:L07558
LNK  NAGB_ECOLI/15-250:P09375:M19284
LNK  NAGB_HAEIN/15-250:P44538:U32700
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GNPI_HUMAN/15-250
ASQ  WAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMD-AREVMILITGAHKAFALYKAIEEGVN-HMWTVSAFQQHPRTVFVCDEDATLELKVK
DSQ  TGGGCGGCTAAATACATCAGGAACCGTATCATCCAGTTTAACCCAGGGCCAGAGAAGTACTTCACCCTGGGGCTCCCCACTGGGAGTACCCCACTTGGCTGCTACAAGAAGCTGATTGAATACTATAAGAATGGGGACCTGTCCTTTAAATATGTGAAGACCTTCAACATGGATGAGTACGTGGGCCTTCCTCGAGACCACCCGGAGAGTTACCACTCCTTCATGTGGAACAACTTCTTCAAGCACATTGACATCCACCCAGAAAACACCCACATTCTGGATGGGAATGCAGTCGACCTACAGGCAGAATGTGATGCCTTTGAAGAGAAGATCAAGGCTGCAGGTGGGATCGAGCTATTTGTTGGAGGCATCGGCCCTGATGGACACATTGCCTTCAACGAGCCAGGCTCCAGTCTGGTGTCCAGGACCCGTGTGAAGACGCTGGCCATGGATACCATCCTGGCCAATGCTAGGTTCTTCGATGGAGAACTCACCAAGGTGCCCACCATGGCCTTGACGGTGGGGGTGGGCACTGTCATGGAT---GCTAGAGAGGTGATGATCCTTATCACAGGTGCTCACAAGGCATTTGCTCTGTACAAGGCCATCGAGGAGGGAGTGAAC---CACATGTGGACCGTGTCTGCCTTCCAGCAGCATCCCCGCACCGTGTTTGTGTGTGACGAGGATGCCACCTTGGAGCTGAAAGTGAAG
TRN  10010101100011011
NAM  NAGB_HAEIN/15-250
ASQ  WAAQHIINRINDFKPTAERPFVLGLPTGGTPLKTYQELIRLYQAGKVSFKHVVTFNMDEYVALPEEHPESYHSFMYNNFFNHIDILPENINILNGNTDDHNAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIKTLTQDTLIANSRFFNNDVTQVPKYALTIGVGTLLD-AEEVMILATGHQKALAVQAAVEGSIN-HLWTVSALQMHRHFLLVCDEAAQQELKVK
DSQ  TGGGCTGCACAACATATCATCAATCGTATCAACGATTTTAAACCTACCGCCGAGCGTCCTTTTGTATTGGGGTTACCTACTGGTGGCACACCACTAAAAACTTATCAAGAACTGATTCGACTTTATCAAGCAGGCAAAGTGAGTTTCAAACACGTAGTGACTTTCAATATGGATGAATATGTGGCTTTACCAGAGGAACACCCTGAAAGTTACCACAGCTTTATGTATAACAATTTTTTCAATCATATCGATATTTTACCTGAAAATATCAATATTCTTAACGGCAATACCGATGACCATAATGCAGAATGCCGTCGTTATGAAGAAAAAATTAAATCCTACGGCAAAATTCATCTGTTTATGGGGGGGGTTGGCGTAGATGGACATATCGCATTTAATGAACCTGCTTCTTCATTAAGTTCTCGCACCCGTATTAAAACGCTAACGCAAGATACATTGATTGCAAATTCACGCTTCTTTAATAATGATGTTACTCAAGTGCCGAAATATGCTTTAACCATTGGTGTTGGCACATTATTAGAT---GCAGAAGAAGTGATGATTTTAGCAACAGGACATCAAAAAGCACTGGCAGTGCAAGCTGCAGTTGAAGGCAGTATTAAC---CATTTATGGACAGTCAGTGCATTACAAATGCACCGTCATTTCTTGCTTGTTTGTGATGAAGCTGCTCAACAAGAGTTAAAAGTGAAA
TRN  11011101101011000
NAM  NAGB_ECOLI/15-250
ASQ  WAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVN-HMWTISCLQLHPKAIMVCDEPSTMELKVK
DSQ  TGGGCTGCTCGCCATATCGTCAATCGTATCAATGCGTTCAAACCGACTGCCGATCGTCCGTTTGTACTGGGCCTGCCGACTGGCGGCACGCCGATGACCACCTATAAAGCGTTAGTCGAAATGCATAAAGCAGGCCAGGTCAGCTTTAAGCACGTTGTCACCTTCAACATGGACGAATATGTCGGTCTGCCGAAAGAGCATCCGGAAAGCTACTACAGCTTTATGCACCGTAATTTCTTCGATCACGTTGATATTCCAGCAGAAAACATCAACCTTCTCAACGGCAACGCCCCGGATATCGACGCCGAGTGCCGCCAGTATGAAGAAAAAATCCGTTCTTACGGAAAAATTCATCTGTTTATGGGCGGTGTAGGTAACGACGGTCATATTGCATTTAACGAACCGGCGTCTTCTCTGGCTTCTCGTACTCGTATCAAAACCCTGACTCATGACACTCGCGTCGCAAACTCTCGTTTCTTTGATAACGATGTTAATCAGGTGCCAAAATATGCCCTGACTGTCGGTGTTGGTACACTGCTGGAT---GCCGAAGAAGTGATGATTCTGGTGCTGGGTAGCCAGAAAGCACTGGCGCTGCAGGCCGCCGTTGAAGGTTGCGTGAAC---CATATGTGGACCATCAGCTGTCTGCAACTGCATCCGAAAGCGATCATGGTGTGCGATGAACCTTCCACCATGGAGCTGAAAGTTAAG
TRN  11011101101011010
NAM  NAG1_CANAL/15-247
ASQ  YLANYIIAKINST-P---RTFVLGLPTGSSPEGIYAKLIEANKQGRVSFKNVVTFNMDEYLGFAPSDLQSYHYFMYDKFFNHIDIPRENIHILNGLAANIDEECANYEKKIKQYGRIDLFLGGLGPEGHLAFNEAGSSRNSKTRKVELVESTIKANCRFFGNDESKVPKYALSVGISTILDNSDEIAIIVLGKSKQFALDKTVNGKPNDPKYPSSYLQDHANVLIVCDN-AAAGLKSK
DSQ  TATTTGGCAAACTATATCATTGCCAAAATCAACTCCACC---CCC---------AGAACATTTGTTCTTGGCCTTCCAACCGGGTCATCCCCTGAAGGCATTTATGCCAAATTGATCGAAGCCAACAAGCAAGGCCGTGTTAGTTTCAAAAACGTCGTGACCTTCAACATGGACGAGTATTTGGGATTTGCCCCATCTGACTTGCAGTCGTACCATTATTTCATGTACGACAAGTTTTTCAACCATATCGATATCCCGCGTGAAAATATCCACATCTTGAACGGATTGGCCGCAAACATCGACGAGGAGTGTGCCAACTACGAAAAGAAAATCAAGCAATACGGAAGAATCGATTTGTTCTTAGGCGGGTTAGGCCCAGAAGGTCATTTGGCATTCAACGAAGCGGGATCATCAAGAAACTCAAAAACAAGAAAGGTCGAGTTGGTCGAAAGTACCATCAAGGCAAACTGCAGGTTTTTCGGGAACGACGAGAGCAAGGTCCCTAAATATGCATTGAGTGTTGGTATTTCCACCATCTTGGACAACTCAGACGAAATTGCCATTATCGTGTTGGGCAAAAGTAAACAATTTGCATTGGACAAAACTGTAAACGGGAAACCAAACGACCCAAAATACCCATCAAGCTATTTACAAGACCACGCAAATGTCTTGATTGTTTGCGATAAC---GCTGCCGCTGGATTAAAGTCAAAG
TRN  10010101110011000
//