EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01096 - TFIIS_C)
FAM  PF01096
PID  TFIIS_C
DES  Transcription factor S-II (TFIIS)
IPR  IPR001222
ANO  7
ALN  39
AID  0.459085
APH  ((((TCEA1_HUMAN/261-299:0.12719,(Q84444_CHVP1/141-179:0.39010,TFS2_YEAST/269-307:0.08086):0.15775):0.30059,TFS2_ASFB7/204-242:0.51774):0.24845,RPOM_SULAC/161-199:0.70397):0.55366,RPO5_VARV/157-195:0.18640,Q98202_MCV1/155-193:0.35156);
ATP  ((((TCEA1_HUMAN/261-299,(Q84444_CHVP1/141-179,TFS2_YEAST/269-307)),TFS2_ASFB7/204-242),RPOM_SULAC/161-199),RPO5_VARV/157-195,Q98202_MCV1/155-193);
ATL  3.61158
DNO  6
DLN  117
DID  0.490028
DPH  ((((TFS2_YEAST/269-307:0.17744,Q84444_CHVP1/141-179:0.39818):0.21937,TCEA1_HUMAN/261-299:0.04347):0.32500,TFS2_ASFB7/204-242:0.27433):0.42215,RPO5_VARV/157-195:0.22961,Q98202_MCV1/155-193:0.46149);
DTP  ((((TFS2_YEAST/269-307,Q84444_CHVP1/141-179),TCEA1_HUMAN/261-299),TFS2_ASFB7/204-242),RPO5_VARV/157-195,Q98202_MCV1/155-193);
DTL  2.55104
RID  0.474761
RPH  (((TCEA1_HUMAN/261-299:0.05802,(Q84444_CHVP1/141-179:0.38862,TFS2_YEAST/269-307:0.08326):0.22301):0.44389,TFS2_ASFB7/204-242:0.37804):0.68941,RPO5_VARV/157-195:0.08010,Q98202_MCV1/155-193:0.46667);
RTP  (((TCEA1_HUMAN/261-299,(Q84444_CHVP1/141-179,TFS2_YEAST/269-307)),TFS2_ASFB7/204-242),RPO5_VARV/157-195,Q98202_MCV1/155-193);
RTL  2.81103
LNK  Q84444_CHVP1/141-179:Q84444:U42580
LNK  Q98202_MCV1/155-193:Q98202:U60315
LNK  RPO5_VARV/157-195:P33796:X69198
LNK  RPOM_SULAC/161-199:Q07271:
LNK  TCEA1_HUMAN/261-299:P23193:X62585
LNK  TFS2_ASFB7/204-242:P27948:M77121
LNK  TFS2_YEAST/269-307:P07273:M60770
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98202_MCV1/155-193
ASQ  APCPVCRGLNTTPMILQTRASDEEPTVRYVCKDCNKHFS
DSQ  GCGCCGTGCCCCGTGTGCCGGGGCCTCAACACCACGCCCATGATCTTGCAAACGCGCGCATCCGACGAGGAGCCGACCGTGCGCTACGTGTGCAAGGACTGCAACAAGCACTTTTCG
TRN  11011111111111111
NAM  RPO5_VARV/157-195
ASQ  TPCPNCKSRNTTPMMIQTRAADEPPLVRHACRDCKQHFK
DSQ  ACACCGTGTCCTAACTGTAAAAGTAGGAATACTACACCGATGATGATTCAAACTAGAGCCGCTGATGAACCTCCATTAGTTAGACACGCGTGTAGAGATTGCAAACAACACTTCAAG
TRN  10110101110011010
NAM  RPOM_SULAC/161-199
ASQ  ISCPSCGNDEAYFWILQTRSADEPATRFYKCTKCGKVWR
NAM  TFS2_ASFB7/204-242
ASQ  YKCPNCKQRMCTYREVQTRALDEPSTIFCTCKKCGHEFI
DSQ  TATAAGTGTCCCAACTGCAAGCAGCGTATGTGCACCTACAGAGAAGTACAAACACGCGCCCTCGATGAGCCTTCCACGATATTTTGTACCTGTAAAAAATGCGGGCATGAGTTTATT
TRN  10010101110011011
NAM  Q84444_CHVP1/141-179
ASQ  LQCGKCKSRKTSYYEMQTRSADEPMTVFAKCHSCGSRWK
DSQ  CTTCAATGCGGTAAATGCAAATCTCGTAAAACGAGCTACTATGAAATGCAAACTAGGAGTGCCGACGAACCTATGACAGTATTCGCGAAATGTCATAGCTGTGGAAGCAGGTGGAAA
TRN  10010101110011011
NAM  TFS2_YEAST/269-307
ASQ  FTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK
DSQ  TTTACTTGTGGTAAATGTAAAGAGAAGAAGGTATCTTACTATCAATTGCAAACAAGATCTGCGGATGAACCATTGACTACTTTCTGTACATGTGAAGCATGTGGTAACAGATGGAAA
TRN  10110101110011011
NAM  TCEA1_HUMAN/261-299
ASQ  FTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWK
DSQ  TTCACATGTGGCAAATGTAAAAAGAAGAATTGCACTTACACACAGGTACAAACCCGTAGTGCTGATGAACCAATGACAACATTTGTTGTCTGTAATGAATGTGGAAATCGATGGAAG
TRN  11111101111011011
//