EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01087 - GalP_UDP_transf)
FAM  PF01087
PID  GalP_UDP_transf
DES  Galactose-1-phosphate uridyl transferase, N-terminal domain
IPR  IPR005849
ANO  10
ALN  222
AID  0.290816
APH  (GAL7_HUMAN/22-196:0.37596,(GAL7_STRLI/2-177:2.09510,GAL7_CRYNE/15-198:0.37642):0.07892,((((GALT_BACSU/18-234:0.57985,(GALT_STRMU/16-225:0.14751,GALT_LACHE/15-221:0.60677):0.20638):2.84694,GAL7_ECOLI/2-176:0.10866):0.10204,GAL7_HAEIN/3-177:0.26793):0.11156,(GAL7_KLULA/1-189:0.23349,GAL7_YEAST/3-191:0.25219):0.31730):0.14451);
ATP  (GAL7_HUMAN/22-196,(GAL7_STRLI/2-177,GAL7_CRYNE/15-198),((((GALT_BACSU/18-234,(GALT_STRMU/16-225,GALT_LACHE/15-221)),GAL7_ECOLI/2-176),GAL7_HAEIN/3-177),(GAL7_KLULA/1-189,GAL7_YEAST/3-191)));
ATL  8.85153
DNO  9
DLN  666
DID  0.426855
DPH  (((GALT_BACSU/18-234:0.46352,(GALT_LACHE/15-221:0.45600,GALT_STRMU/16-225:0.26567):0.07556):1.36186,(GAL7_KLULA/1-189:0.21340,GAL7_YEAST/3-191:0.28308):0.08828):0.13927,(GAL7_CRYNE/15-198:0.37729,GAL7_HUMAN/22-196:0.33883):0.10506,(GAL7_ECOLI/2-176:0.25762,GAL7_HAEIN/3-177:0.27299):0.11165);
DTP  (((GALT_BACSU/18-234,(GALT_LACHE/15-221,GALT_STRMU/16-225)),(GAL7_KLULA/1-189,GAL7_YEAST/3-191)),(GAL7_CRYNE/15-198,GAL7_HUMAN/22-196),(GAL7_ECOLI/2-176,GAL7_HAEIN/3-177));
DTL  4.81008
RID  0.320957
RPH  (((GAL7_HUMAN/22-196:0.22901,(GAL7_CRYNE/15-198:0.45933,((GAL7_ECOLI/2-176:0.21262,GAL7_HAEIN/3-177:0.26539):0.11056,(GAL7_KLULA/1-189:0.23285,GAL7_YEAST/3-191:0.25394):0.32353):0.13384):0.15634):2.91010,GALT_BACSU/18-234:0.51352):0.27048,GALT_STRMU/16-225:0.15792,GALT_LACHE/15-221:0.60261);
RTP  (((GAL7_HUMAN/22-196,(GAL7_CRYNE/15-198,((GAL7_ECOLI/2-176,GAL7_HAEIN/3-177),(GAL7_KLULA/1-189,GAL7_YEAST/3-191)))),GALT_BACSU/18-234),GALT_STRMU/16-225,GALT_LACHE/15-221);
RTL  6.76937
LNK  GAL7_CRYNE/15-198:P40908:U16994
LNK  GAL7_ECOLI/2-176:P09148:U00096
LNK  GAL7_HAEIN/3-177:P31764:X65934
LNK  GAL7_HUMAN/22-196:P07902:M60091
LNK  GAL7_KLULA/1-189:P09580:X07039
LNK  GAL7_STRLI/2-177:P13212:
LNK  GAL7_YEAST/3-191:P08431:X81324
LNK  GALT_BACSU/18-234:P39575:X73124
LNK  GALT_LACHE/15-221:Q00054:X57248
LNK  GALT_STRMU/16-225:P96994:AE014930
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GAL7_YEAST/3-191
ASQ  EEFDFSSHSHRRYNPLTDSWILVSPHRAKRP--------------WLGQQEAAYKPTAPLYDPKCY---LCPGNKRATGNLNPRYESTYI------FPNDYAAVRLDQPILPQNDSNEDNLKNRLLKVQSVRG--NCFVICFS-PNHNLTIPQMKQSDLVHIVNSWQALTDDLSREARENHKPFKYVQIFE-NKGTAMGCSNLHP------HGQAWCLESIP
DSQ  GAAGAATTTGATTTTTCTAGCCATTCCCATAGACGTTACAATCCACTAACCGATTCATGGATCTTAGTTTCTCCACACAGAGCTAAAAGACCT------------------------------------------TGGTTAGGTCAACAGGAGGCTGCTTACAAGCCCACAGCTCCATTGTATGATCCAAAATGCTAT---------CTATGTCCTGGTAACAAAAGAGCTACTGGTAACCTAAACCCAAGATATGAATCAACGTATATT------------------TTCCCCAATGATTATGCTGCCGTTAGGCTCGATCAACCTATTTTACCACAGAATGATTCCAATGAGGATAATCTTAAAAATAGGCTGCTTAAAGTGCAATCTGTGAGAGGC------AATTGTTTCGTCATATGTTTTAGC---CCCAATCATAATCTAACCATTCCACAAATGAAACAATCAGATCTGGTTCATATTGTTAATTCTTGGCAAGCATTGACTGACGATCTCTCCAGAGAAGCAAGAGAAAATCATAAGCCTTTCAAATATGTCCAAATATTTGAA---AACAAAGGTACAGCCATGGGTTGTTCCAACTTACATCCA------------------CATGGCCAAGCTTGGTGCTTAGAATCCATCCCT
TRN  10010101100011000
NAM  GAL7_KLULA/1-189
ASQ  MSFDLTDHSHARYNPLTDSWILVSPHRAKRP--------------WLGQQEKPGRNDAPDHDDKCY---LCPGTTRATGEQNPDYESTYV------FTNGYPAVKLEQPDPELTVSNCDALKERLFKLKGVKG--NCYVICFS-PKHNLSFPQMAQSEIMNVVKTWTNLFQTLEKEALEENKPYKYLQIFE-NKGTAMGCSNLHP------HGQAWCLDSIP
DSQ  ATGTCTTTTGACTTAACAGATCACTCACATGCACGTTACAATCCATTGACTGATTCTTGGATTTTGGTATCTCCACATAGAGCCAAGAGACCA------------------------------------------TGGTTAGGTCAACAGGAGAAACCTGGTAGAAACGATGCTCCAGACCACGACGATAAATGCTAC---------TTATGTCCCGGTACTACCAGGGCTACAGGTGAGCAGAACCCAGATTACGAATCTACATATGTC------------------TTCACTAACGGCTATCCAGCTGTGAAATTAGAACAACCAGATCCAGAACTGACGGTGTCGAATTGCGACGCATTGAAGGAGAGATTGTTCAAGTTGAAAGGTGTGAAAGGT------AACTGTTATGTGATCTGCTTCTCT---CCAAAACATAACCTAAGTTTCCCACAAATGGCTCAAAGTGAGATCATGAATGTTGTCAAAACGTGGACTAACTTATTCCAGACTTTGGAGAAAGAAGCCTTGGAAGAGAACAAGCCTTATAAATATCTACAAATTTTCGAA---AATAAGGGTACTGCTATGGGTTGCTCTAATTTACATCCT------------------CATGGTCAGGCTTGGTGTTTAGATTCCATTCCA
TRN  10010101100011000
NAM  GAL7_HAEIN/3-177
ASQ  ALFEPTEHPHRRYNPLIDQWVLVSPHRAKRP--------------WQGQQEKVNEEQKPSYDPTCY---LCPSNKRITGELNPDYRKPYV------FKNDFSALLEDTPAPEKS-------SDPLFQSSQARG--ESRVICFS-PDHSKTLPLLTALEIEEVIKVWQEQLRELG-------AKYQWVQIFE-NKGAAMGCSNPHP------HGQIWANSFLP
DSQ  GCACTTTTTGAACCTACAGAACATCCACATCGTCGCTACAATCCGTTAATCGATCAATGGGTTTTAGTTTCGCCACATCGTGCCAAACGCCCG------------------------------------------TGGCAAGGGCAACAGGAAAAAGTCAATGAAGAACAAAAACCAAGTTATGATCCAACTTGTTAT---------CTTTGCCCGAGTAATAAGCGTATTACAGGGGAATTAAATCCAGATTATCGTAAACCTTATGTG------------------TTTAAAAATGATTTTTCCGCGCTTTTAGAAGATACGCCAGCCCCTGAAAAATCC---------------------TCCGATCCTCTTTTCCAAAGTTCTCAAGCTCGTGGG------GAAAGTCGAGTCATTTGTTTCTCT---CCCGATCATAGTAAAACATTGCCATTATTGACCGCACTTGAGATTGAAGAAGTGATTAAAGTATGGCAGGAACAACTTCGTGAACTTGGT---------------------GCGAAATACCAATGGGTGCAAATTTTTGAA---AACAAAGGGGCGGCAATGGGGTGTTCTAACCCACATCCA------------------CATGGTCAAATTTGGGCGAATAGTTTCTTGCCA
TRN  11011101111011010
NAM  GAL7_ECOLI/2-176
ASQ  TQFNPVDHPHRRYNPLTGQWILVSPHRAKRP--------------WQGAQETPAKQVLPAHDPDCF---LCAGNVRVTGDKNPDYTGTYV------FTNDFAALMSDTPDAPES-------HDPLMRCQSARG--TSRVICFS-PDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYPWVQVFE-NKGAAMGCSNPHP------HGQIWANSFLP
DSQ  ACGCAATTTAATCCCGTTGATCATCCACATCGCCGCTACAACCCGCTCACCGGGCAATGGATTCTGGTTTCACCGCACCGCGCTAAGCGCCCC------------------------------------------TGGCAGGGGGCGCAGGAAACGCCAGCCAAACAGGTGTTACCTGCGCACGATCCAGATTGCTTC---------CTCTGCGCAGGTAATGTGCGGGTGACAGGCGATAAAAACCCCGATTACACCGGGACTTACGTT------------------TTCACTAATGACTTTGCGGCTTTGATGTCTGACACGCCAGATGCGCCAGAAAGT---------------------CACGATCCGCTGATGCGTTGCCAGAGCGCGCGCGGC------ACCAGCCGGGTGATCTGCTTTTCA---CCGGATCACAGTAAAACGCTGCCAGAGCTCAGCGTTGCAGCATTGACGGAAATCGTCAAAACCTGGCAGGAGCAAACCGCAGAACTGGGG---------------------AAAACGTACCCATGGGTGCAGGTTTTTGAA---AACAAAGGCGCGGCGATGGGCTGCTCTAACCCGCATCCG------------------CACGGTCAGATTTGGGCAAATAGCTTCCTGCCT
TRN  11011101101011000
NAM  GAL7_HUMAN/22-196
ASQ  ATFRANDHQHIRYNPLQDEWVLVSAHRMKRP--------------WQGQVEPQLLKTVPRHDPLNP---LCPGAIRANGEVNPQYDSTFL------FDNDFPALQPDAPSPGPS-------DHPLFQAKSARG--VCKVMCFH-PWSDVTLPLMSVPEIRAVVDAWASVTEELG-------AQYPWVQIFE-NKGAMMGCSNPHP------HCQVWASSFLP
DSQ  GCAACCTTCCGGGCAAACGACCATCAGCATATCCGCTACAACCCGCTGCAGGATGAGTGGGTGCTGGTGTCAGCTCACCGCATGAAGCGGCCC------------------------------------------TGGCAGGGTCAAGTGGAGCCCCAGCTTCTGAAGACAGTGCCCCGCCATGACCCTCTCAACCCT---------CTGTGTCCTGGGGCCATCCGAGCCAACGGAGAGGTGAATCCCCAGTACGATAGCACCTTCCTG------------------TTTGACAACGACTTCCCAGCTCTGCAGCCTGATGCCCCCAGTCCAGGACCCAGT---------------------GATCATCCCCTTTTCCAAGCAAAGTCTGCTCGAGGA------GTCTGTAAGGTCATGTGCTTCCAC---CCCTGGTCGGATGTAACGCTGCCACTCATGTCGGTCCCTGAGATCCGGGCTGTTGTTGATGCATGGGCCTCAGTCACAGAGGAGCTGGGT---------------------GCCCAGTACCCTTGGGTGCAGATCTTTGAA---AACAAAGGTGCCATGATGGGCTGTTCTAACCCCCACCCC------------------CACTGCCAGGTATGGGCCAGCAGTTTCCTGCCA
TRN  11011101101011001
NAM  GAL7_CRYNE/15-198
ASQ  TPVSINDHVHRRFNPLLGKHVLVSPHRSLRP--------------WNGQKETPAIPVETPHDSKCY---LCPGNKRTTGQHNPDYKGIYV------FENDFPALLPDPLAVGTN----KISDDPLFQSEPVRG--RCKVICFH-PRHDLTMAAMRISEINHVLDGWKDVYAEEGK-IMQEESSDGCVQIFE-NRGAMMGCSAPHP------HGQVWTTSFVP
DSQ  ACACCTGTGTCCATAAATGATCACGTTCATCGGCGCTTCAACCCTCTCCTTGGCAAGCATGTTCTAGTCTCCCCACATAGATCGCTGAGACCA------------------------------------------TGGAACGGCCAGAAGGAAACCCCTGCTATCCCCGTTGAAACCCCTCACGACTCTAAATGCTAC---------TTGTGTCCTGGTAATAAACGCACGACCGGGCAACACAATCCTGATTATAAGGGTATTTATGTC------------------TTCGAGAACGACTTTCCAGCGTTGCTTCCCGACCCTCTGGCTGTTGGGACCAAC------------AAGATCTCCGATGATCCATTATTCCAGTCTGAACCAGTCAGAGGA------CGGTGCAAGGTGATTTGTTTCCAT---CCCCGGCATGACCTGACCATGGCAGCTATGAGGATTTCAGAGATCAATCATGTTTTGGACGGGTGGAAAGACGTTTATGCGGAGGAAGGGAAG---ATCATGCAAGAGGAGAGTTCAGACGGCTGTGTGCAAATCTTTGAG---AACCGAGGCGCAATGATGGGTTGTTCCGCACCGCATCCT------------------CATGGTCAAGTGTGGACCACTTCATTTGTTCCC
TRN  10010101100011000
NAM  GAL7_STRLI/2-177
ASQ  KKTSTRLADGRELVYYDLRDDTVRDAVDRRP--------------LERTVTTSEVRRDPLLGDSAP----SRLAPQGRTYHPPADQCPLC-------PSGRGTAERDPAYDVVV------FENRFPSLAGDSG--RCEVVCFT-SDHDASFADLSEEQARLVVDAWTDRTSELS-----HLPSVEQVFCFE-NRGAEIGVTLGHP------HGQIYAYPFTT
NAM  GALT_LACHE/15-221
ASQ  GAYEPLDRVYVINKIRALVGDHDEEEENDQP---------AAKQLVDLAVKNEKIP-DDITSREVLNDQLYDLATPTPSKTNSIFWQKMQ-KSSEENTDWFYKLCEDNNYVKKE----AIAKNVVFSGTSSKGHSLEITINLSKPEKDPKAIAAAAHATGKKYPQCALCLENEGYLGGYGKNARSNLRIIRMNIAGRPWGFQYSPYAYFNEHCIFLDQKHIP
DSQ  GGAGCCTACGAACCATTAGATCGAGTATATGTCATTAATAAAATTAGAGCATTAGTTGGTGATCATGACGAAGAAGAAGAAAATGATCAACCG---------------------------GCAGCTAAGCAGTTAGTTGATTTAGCAGTTAAGAATGAAAAAATTCCG---GATGACATCACTTCTCGTGAAGTGCTAAATGATCAACTTTATGATCTAGCTACCCCAACACCATCTAAGACCAATAGTATTTTCTGGCAAAAAATGCAA---AAGTCTTCAGAAGAGAACACTGATTGGTTCTATAAATTATGTGAAGACAACAATTATGTTAAAAAAGAA------------GCTATTGCTAAGAATGTTGTTTTCTCAGGTACTAGTTCTAAAGGCCACAGCTTAGAAATTACAATTAACTTATCCAAGCCTGAAAAAGATCCGAAGGCCATCGCTGCGGCAGCACATGCAACAGGTAAGAAATATCCTCAATGTGCGCTTTGTCTTGAAAATGAAGGCTATTTAGGTGGTTATGGTAAGAATGCTCGTTCTAATTTAAGAATTATCCGCATGAACATTGCAGGCCGTCCATGGGGCTTCCAATATTCACCTTATGCATACTTTAATGAACACTGCATTTTCTTGGATCAAAAGCATATTCCA
TRN  10010101110011000
NAM  GALT_STRMU/16-225
ASQ  SDYAELDATYLSNRILALVGEDNAQQDTNQS-----NLIALKDELVDLAVVNGKVG-DLAEEKDCLGAELMNFITPIPSQVNKAFWDTNA-KSPQKAIKDFYELSKRNNYIKVT----AIAKNIAFTTSSVYG-DIDITINLSKPEKDPKAIAAAKLAKTSNYPKCQLCMENEGYQGRINYPARANHRIIRMNLGDEKWGFQYSPYAYFNEHCIFLNTEHVP
DSQ  AGTGACTATGCTGAGTTGGATGCTACCTACCTTAGCAATCGTATTCTTGCTTTGGTCGGTGAAGACAATGCTCAGCAGGATACAAACCAAAGC---------------AACCTCATTGCTCTTAAGGATGAATTGGTTGATTTGGCTGTTGTGAACGGTAAAGTTGGC---GACTTAGCTGAAGAGAAAGATTGCTTGGGAGCGGAGTTAATGAACTTCATCACGCCAATTCCAAGTCAGGTCAATAAAGCTTTCTGGGATACTAATGCA---AAATCTCCTCAGAAAGCTATCAAAGATTTCTATGAACTCAGTAAGCGTAACAACTATATTAAAGTGACC------------GCTATTGCTAAAAATATTGCTTTCACAACGTCATCAGTTTATGGG---GATATTGACATTACTATCAATTTGTCAAAACCTGAAAAGGATCCTAAAGCTATTGCAGCAGCTAAGTTAGCTAAGACTTCCAATTATCCCAAGTGCCAACTTTGCATGGAAAATGAAGGCTATCAGGGTAGGATTAATTATCCTGCTCGTGCCAACCATCGCATTATCCGTATGAATTTGGGTGATGAGAAATGGGGCTTCCAGTATTCTCCTTACGCTTATTTCAACGAGCACTGCATTTTTCTCAACACTGAGCATGTACCT
TRN  10010101110011000
NAM  GALT_BACSU/18-234
ASQ  KLISIWDREYTRNRLYEALGITHPEPNSSTSIKQSQSLPDLLAPIYKWAAETGRMEADTDTYRDLLSAKLMGCFVPAPSEVIRKFEETKALYGPKQATKEFYQYSEDVYYIRTD----RIAKNVHWTVPTEYG-ELEMTINLSKPEKDPKAIAAAKEQEQTNYPMCLLCKENVGFEGSVNHPARQNHRIIPVILEDEQWFLQFSPYVYYPEHCIVLKGEHEP
DSQ  AAATTGATTTCGATCTGGGATCGGGAATATACGAGAAACCGTCTTTATGAAGCGCTGGGCATCACACATCCCGAGCCGAACTCCAGCACCAGCATCAAGCAGTCACAAAGCCTGCCGGACTTGCTAGCTCCCATCTATAAATGGGCTGCCGAAACCGGCCGAATGGAAGCGGATACAGATACGTACCGTGACCTGCTCAGCGCAAAGCTGATGGGCTGTTTTGTGCCTGCCCCGTCCGAGGTCATTCGCAAATTTGAAGAGACAAAAGCATTATACGGCCCAAAACAGGCGACAAAGGAATTCTATCAATATTCAGAGGATGTCTATTATATACGGACTGAC------------AGAATCGCCAAAAATGTTCATTGGACGGTGCCGACCGAATATGGC---GAGCTGGAAATGACCATTAACCTATCAAAGCCTGAAAAGGACCCGAAAGCGATTGCGGCTGCAAAAGAGCAGGAACAGACAAATTATCCGATGTGTTTGCTGTGTAAAGAAAATGTCGGCTTCGAGGGAAGCGTGAATCATCCAGCCCGGCAAAATCACAGAATCATTCCGGTCATCCTTGAGGACGAACAATGGTTCCTGCAATTCTCGCCATATGTCTATTATCCGGAGCACTGCATTGTCTTAAAAGGTGAACATGAACCG
TRN  10010101100011000
//