EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00944 - Alpha_core)
FAM  PF00944
PID  Alpha_core
DES  Alphavirus core protein
IPR  IPR000930
ANO  5
ALN  159
AID  0.639849
APH  (POLS_EEEV/103-260:0.13056,(P89946_BFV/98-255:0.23433,(P89913_SINDV/109-267:0.11956,Q86925_9VIRU/110-268:0.16008):0.19258):0.18885,O41516_9VIRU/119-276:0.13726);
ATP  (POLS_EEEV/103-260,(P89946_BFV/98-255,(P89913_SINDV/109-267,Q86925_9VIRU/110-268)),O41516_9VIRU/119-276);
ATL  1.16322
DNO  5
DLN  477
DID  0.616221
DPH  (((O41516_9VIRU/119-276:0.20789,POLS_EEEV/103-260:0.16498):0.18248,P89946_BFV/98-255:0.22999):0.18019,Q86925_9VIRU/110-268:0.18804,P89913_SINDV/109-267:0.20036);
DTP  (((O41516_9VIRU/119-276,POLS_EEEV/103-260),P89946_BFV/98-255),Q86925_9VIRU/110-268,P89913_SINDV/109-267);
DTL  374.049
RID  0.639849
RPH  (POLS_EEEV/103-260:0.13056,(P89946_BFV/98-255:0.23433,(P89913_SINDV/109-267:0.11956,Q86925_9VIRU/110-268:0.16008):0.19258):0.18885,O41516_9VIRU/119-276:0.13726);
RTP  (POLS_EEEV/103-260,(P89946_BFV/98-255,(P89913_SINDV/109-267,Q86925_9VIRU/110-268)),O41516_9VIRU/119-276);
RTL  1.16322
LNK  O41516_9VIRU/119-276:O41516:U82699
LNK  P89913_SINDV/109-267:P89913:U90536
LNK  P89946_BFV/98-255:P89946:U73745
LNK  POLS_EEEV/103-260:P08768:X05816
LNK  Q86925_9VIRU/110-268:Q86925:AF126284
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O41516_9VIRU/119-276
ASQ  VMKLESDKTFPILL-DGKINGYACVVGGKLFRPMHVEGKIDNETLASLKTKKASKYDLEYADVPQSMRADTFKYTHDKPQGYYNWHHGAVQYENGRFTVPKGVGAKGDSGRPILDNQGRVVAIVLGGVNEGSKTALSVVMWNEKGVTVKYTPENCEQWS
DSQ  GTTATGAAGTTAGAATCAGACAAAACATTTCCTATTTTGCTG---GATGGAAAAATTAATGGATATGCTTGCGTTGTTGGAGGAAAGCTATTTCGACCCATGCACGTGGAAGGCAAAATTGACAATGAAACTCTTGCCTCCCTGAAGACGAAGAAGGCATCCAAATACGACCTAGAGTATGCCGATGTTCCTCAAAGCATGCGAGCAGATACCTTTAAATACACACATGATAAGCCTCAAGGGTATTATAATTGGCATCACGGCGCCGTGCAGTATGAAAATGGGAGATTCACGGTGCCGAAAGGTGTGGGAGCGAAAGGAGACAGTGGACGCCCCATACTAGATAATCAAGGCAGAGTCGTGGCCATTGTGCTGGGAGGGGTGAATGAAGGATCCAAGACAGCTTTGTCCGTAGTTATGTGGAATGAAAAAGGGGTCACCGTAAAATATACACCAGAAAACTGTGAGCAATGGTCA
TRN  10010101100011000
NAM  POLS_EEEV/103-260
ASQ  CMKLESDKTFPIML-NGQVNGYACVVGGRVFKPLHVEGRIDNEQLAAIKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRFTVPRGVGGKGDSGRPILDNKGRVVAIVQGGVNEGSRTALSVVTWNQKGVTVKDTPEGSEPWS
DSQ  TGTATGAAGCTAGAGTCAGATAAAACGTTTCCGATCATGTTG---AACGGACAGGTGAATGGTTACGCGTGCGTCGTGGGTGGACGAGTGTTTAAACCGCTGCACGTAGAAGGCAGAATAGACAATGAGCAACTGGCCGCTATCAAGCTGAAGAAGGCCAGCATATATGACCTTGAGTACGGTGATGTGCCACAATGCATGAAATCAGATACCCTCCAGTACACCAGTGACAAGCCTCCTGGCTTTTATAACTGGCATCATGGAGCTGTGCAGTATGAGAACAACAGGTTCACCGTACCACGAGGGGTCGGTGGAAAGGGCGACAGCGGGAGACCTATTCTTGACAACAAAGGTAGAGTCGTCGCAATTGTCCAGGGTGGAGTCAACGAAGGATCCAGGACGGCTCTATCAGTGGTGACATGGAACCAAAAGGGGGTTACAGTCAAAGATACACCAGAGGGGTCAGAGCCATGGTCG
TRN  10010101100011001
NAM  P89946_BFV/98-255
ASQ  CMKIENDCIFPVML-DGKVNGYACLVGDKVMKPAHVKGTIDNPELAKLTFKKSSKYDLECAQVPVCMKSDASKFTHEKPEGHYNWHHGAVQFSNGRFTIPTGSGKPGDSGRPIFDNTGKVVAIVLGGANEGARTALSVVTWNKDMVTRITPEESVEWSA
DSQ  TGCATGAAGATCGAGAATGACTGCATCTTTCCGGTGATGCTC---GATGGAAAGGTTAACGGCTACGCTTGCTTAGTGGGGGATAAAGTCATGAAACCAGCTCATGTGAAGGGCACGATCGACAATCCAGAACTAGCCAAATTGACATTCAAGAAATCTAGCAAGTATGATCTAGAATGTGCTCAAGTGCCGGTATGCATGAAATCAGACGCATCCAAGTTCACCCATGAGAAACCAGAAGGACATTACAACTGGCACCATGGGGCAGTGCAATTTAGCAATGGTAGGTTTACCATTCCGACGGGCTCTGGCAAACCTGGAGACAGTGGTAGGCCTATTTTTGACAATACCGGCAAGGTAGTAGCCATAGTGCTGGGAGGTGCAAATGAAGGGGCCCGGACAGCCCTATCCGTGGTCACCTGGAATAAGGATATGGTGACCCGCATAACACCTGAAGAATCAGTGGAGTGGTCGGCG
TRN  10010101100011000
NAM  P89913_SINDV/109-267
ASQ  ALKLEADRLFDVKNEAGEVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPTNMRSEAFSYTSEHPEGFYNWHHGAVQYSGGRFTVPKGAGGKGDSGRPIMDNTGKVVAIVLGGADEGARTALSVVTWNSKGKTIKTTPEGTEEWS
DSQ  GCGCTGAAACTAGAGGCAGACCGTCTGTTTGATGTGAAGAATGAAGCAGGCGAAGTGATAGGCCATGCCCTGGCTATGGAAGGTAAGGTGATGAAACCGCTCCACGTAAAAGGCACTATAGACCACCCGGTGCTATCGAAGCTGAAGTTCACTAAGTCATCGGCTTATGACATGGAGTTCGCGCAGCTCCCCACCAACATGCGGAGTGAGGCGTTCTCCTACACCAGCGAACACCCTGAAGGGTTCTATAACTGGCACCATGGCGCTGTTCAATACAGCGGAGGAAGGTTTACAGTGCCGAAAGGAGCAGGAGGAAAAGGGGACAGTGGACGCCCGATTATGGACAACACGGGAAAGGTTGTCGCCATCGTCCTCGGTGGCGCCGACGAAGGGGCCCGTACTGCCCTATCCGTGGTCACCTGGAATAGCAAGGGAAAGACCATCAAGACGACGCCCGAAGGGACAGAAGAATGGTCA
TRN  10010101100011001
NAM  Q86925_9VIRU/110-268
ASQ  ALKFEADRTFVGKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEVFYNWHHGAVQFSGGRFTIPTGVGGPGDSGRPILDNSGKVVAIVLGGANEVPGTALSVVTWNKKGAAIKTTHEDTVEWS
DSQ  GCCCTGAAATTTGAAGCCGACCGCACATTTGTCGGGAAGAATGAAGACGGCAAGATTATGGGATACGCCGTTGCCATGGAAGGGAAAGTGATAAAACCACTACATGTAAAAGGAACCATTGACCACCCGGCCCTAGCGAAACTTAAATTCACTAAATCTTCTTCTTACGACATGGAGTTTGCTAAACTACCGACCGAAATGAAAAGCGACGCATTCGGGTATACAACGGAACACCCCGAAGTATTTTACAACTGGCATCACGGAGCTGTCCAATTTTCCGGCGGAAGGTTCACCATCCCTACAGGAGTCGGAGGCCCCGGAGATAGCGGAAGGCCTATACTGGATAACTCCGGAAAAGTGGTAGCCATAGTCCTAGGAGGAGCTAATGAAGTGCCAGGAACGGCACTTTCTGTTGTCACCTGGAATAAGAAGGGAGCCGCTATTAAAACCACCCACGAAGATACTGTAGAGTGGTCG
TRN  10010101100011011
//