EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00915 - Calici_coat)
FAM  PF00915
PID  Calici_coat
DES  Calicivirus coat protein
IPR  IPR004005
ANO  11
ALN  314
AID  0.407009
APH  ((((((COAT_LORDV/2-292:0.19832,Q66296_9CALI/2-292:0.11401):0.06019,O12305_9CALI/2-292:0.09040):0.23187,(Q66418_9CALI/2-297:0.10894,(COAT_SOUV3/2-297:0.13693,Q83876_9CALI/2-296:0.15743):0.06528):0.20871):0.91172,(POLN_RHDV/1768-2066:0.80402,O09725_9CALI/267-561:0.82627):0.17444):0.43802,COAT_FCVC6/107-396:0.38411):0.08865,P89681_9CALI/137-422:0.13299,COAT_SMSV1/137-427:0.10335);
ATP  ((((((COAT_LORDV/2-292,Q66296_9CALI/2-292),O12305_9CALI/2-292),(Q66418_9CALI/2-297,(COAT_SOUV3/2-297,Q83876_9CALI/2-296))),(POLN_RHDV/1768-2066,O09725_9CALI/267-561)),COAT_FCVC6/107-396),P89681_9CALI/137-422,COAT_SMSV1/137-427);
ATL  5.22293
DNO  11
DLN  942
DID  0.472859
DPH  (Q66296_9CALI/2-292:0.17097,(COAT_LORDV/2-292:0.23182,O12305_9CALI/2-292:0.18973):0.04350,(((COAT_FCVC6/107-396:0.29679,(P89681_9CALI/137-422:0.22675,COAT_SMSV1/137-427:0.14060):0.16783):0.24766,(O09725_9CALI/267-561:0.51673,POLN_RHDV/1768-2066:0.55436):0.10263):0.56080,(Q66418_9CALI/2-297:0.14177,(COAT_SOUV3/2-297:0.19241,Q83876_9CALI/2-296:0.19898):0.06931):0.14960):0.16805);
DTP  (Q66296_9CALI/2-292,(COAT_LORDV/2-292,O12305_9CALI/2-292),(((COAT_FCVC6/107-396,(P89681_9CALI/137-422,COAT_SMSV1/137-427)),(O09725_9CALI/267-561,POLN_RHDV/1768-2066)),(Q66418_9CALI/2-297,(COAT_SOUV3/2-297,Q83876_9CALI/2-296))));
DTL  4.37029
RID  0.407009
RPH  ((((((COAT_LORDV/2-292:0.19832,Q66296_9CALI/2-292:0.11401):0.06019,O12305_9CALI/2-292:0.09040):0.23187,(Q66418_9CALI/2-297:0.10894,(COAT_SOUV3/2-297:0.13693,Q83876_9CALI/2-296:0.15743):0.06528):0.20871):0.91172,(POLN_RHDV/1768-2066:0.80402,O09725_9CALI/267-561:0.82627):0.17444):0.43802,COAT_FCVC6/107-396:0.38411):0.08865,P89681_9CALI/137-422:0.13299,COAT_SMSV1/137-427:0.10335);
RTP  ((((((COAT_LORDV/2-292,Q66296_9CALI/2-292),O12305_9CALI/2-292),(Q66418_9CALI/2-297,(COAT_SOUV3/2-297,Q83876_9CALI/2-296))),(POLN_RHDV/1768-2066,O09725_9CALI/267-561)),COAT_FCVC6/107-396),P89681_9CALI/137-422,COAT_SMSV1/137-427);
RTL  5.22293
LNK  COAT_FCVC6/107-396:P27404:M32819
LNK  COAT_LORDV/2-292:P54635:X86557
LNK  COAT_SMSV1/137-427:P36284:M87481
LNK  COAT_SOUV3/2-297:Q04542:L07418
LNK  O09725_9CALI/267-561:O09725:U73124
LNK  O12305_9CALI/2-292:O12305:U75682
LNK  P89681_9CALI/137-422:P89681:U76874
LNK  POLN_RHDV/1768-2066:P27410:M67473
LNK  Q66296_9CALI/2-292:Q66296:U02030
LNK  Q66418_9CALI/2-297:Q66418:U04469
LNK  Q83876_9CALI/2-296:Q83876:L23828
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q83876_9CALI/2-296
ASQ  MMASKD--------ATSSVDGASASVQLVPEVNA-SDPLAMDPVAGSSTAVATAGQVNPID---PWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSQQLTIAQATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLSTGGGTG--DSFVVAGRVMTCPSPDFNFLFLVPP--TVEQKTRP---FTLPNLPLSSLSNSRAPLPISGMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNG
DSQ  ATGATGGCGTCTAAGGAC------------------------GCTACGTCAAGCGTGGATGGCGCCAGTGCGTCGGTTCAGTTGGTACCGGAGGTTAATGCT---TCTGACCCTCTTGCAATGGATCCTGTGGCGGGTTCTTCAACAGCAGTTGCAACCGCTGGACAAGTTAACCCTATTGAC---------CCTTGGATAATCAATAACTTTGTGCAGGCTCCCCAAGGTGAATTTACTATTTCTCCAAATAATACCCCCGGTGATGTTTTGTTTGATTTGAGTCTAGGCCCTCATCTTAATCCCTTCTTGTTACATTTGTCACAAATGTATAATGGCTGGGTTGGCAACATGAGAGTTAGGATTATGCTGGCTGGTAATGCATTTACTGCAGGCAAAATTATAGTTTCTTGCATACCTCCTGGCTTTGGCTCCCAACAACTTACTATAGCACAAGCAACTCTCTTCCCGCATGTGATTGCTGATGTTAGGACTTTAGACCCAATTGAAGTACCCTTGGAAGATGTAAGGAATGTTCTCTTTCATAATAATGATAGAAATCAACAAACTATGCGCCTTGTGTGCATGCTTTATACCCCCCTCAGCACTGGTGGCGGTACAGGT------GATTCTTTTGTGGTTGCAGGGCGAGTCATGACTTGTCCTAGCCCCGACTTTAATTTCTTGTTCTTGGTTCCTCCC------ACAGTGGAACAGAAGACTAGGCCT---------TTCACCCTCCCAAATTTACCGCTGAGTTCTTTGTCTAATTCACGTGCTCCTCTTCCAATTAGTGGCATGGGTATTTCTCCAGATAATGTTCAGAGTGTGCAGTTCCAAAATGGCCGATGTACCTTAGATGGACGTCTTGTTGGCACCACCCCAGTTTCCCTCTCCCATGTTGCTAAGATAAGGGGTACTTCTAATGGT
TRN  10010101100011000
NAM  COAT_SOUV3/2-297
ASQ  MMASKD--------APQSADGASGAGQLVPEVNT-ADPLPMEPVAGPTTAVATAGQVNMID---PWIVNNFVQSPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLSQMYNGWVGNMRVRILLAGNAFSAGKIIVCCVPPGFTSSSLTIAQATLFPHVIADVRTLEPIEMPLEDVRNVLYHTND-NQPTMRLVCMLYTPLRTGGGSGNSDSFVVAGRVLTAPSSDFSFLFLVPP--TIEQKTRA---FTVPNIPLQTLSNSRFPSLIQGMILSPDASQVVQFQNGRCLIDGQLLGTTPATSGQLFRVRGKINQ
DSQ  ATGATGGCGTCTAAGGAC------------------------GCCCCTCAAAGCGCTGATGGCGCAAGCGGCGCAGGTCAACTGGTGCCGGAGGTTAATACA---GCTGACCCCTTACCCATGGAACCCGTGGCCGGGCCAACAACAGCCGTAGCCACTGCTGGGCAAGTTAATATGATTGAT---------CCCTGGATTGTTAATAATTTTGTCCAGTCACCACAAGGTGAGTTCACAATTTCCCCTAATAATACCCCCGGTGATATTTTGTTTGATTTACAATTAGGTCCACATCTAAACCCTTTCTTGTCACATTTGTCCCAAATGTATAATGGCTGGGTTGGAAATATGAGAGTTAGGATTCTTCTTGCTGGGAATGCTTTCTCAGCTGGAAAGATTATAGTTTGTTGTGTCCCCCCTGGCTTCACGTCTTCCTCTCTCACCATAGCTCAGGCTACATTGTTTCCCCATGTGATTGCTGATGTGAGAACCCTTGAACCAATAGAAATGCCTCTCGAGGATGTACGCAATGTCCTCTATCACACCAATGAT---AATCAACCAACAATGCGGTTGGTGTGTATGCTCTACACGCCGCTCCGTACTGGTGGGGGATCTGGTAATTCTGATTCTTTCGTAGTTGCTGGTAGGGTGCTCACGGCTCCTAGTAGCGACTTCAGTTTCTTGTTCCTTGTCCCACCT------ACTATAGAACAGAAGACTCGGGCT---------TTTACTGTGCCTAATATCCCCTTGCAAACCTTGTCCAATTCTAGATTTCCTTCCCTCATCCAGGGGATGATCCTGTCTCCTGACGCATCTCAAGTGGTCCAGTTTCAAAATGGACGATGCCTTATAGATGGCCAACTCCTAGGCACCACACCCGCTACATCAGGACAGCTGTTCAGAGTAAGAGGAAAGATAAATCAG
TRN  10010101100011000
NAM  Q66418_9CALI/2-297
ASQ  MMASKD--------APTNMDGTSGAGQLVPEANT-AEPISMEPVAGAATAAATAGQVNMID---PWIMSNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNGWVGNMRVKVLLAGNAFTAGKIIISCIPPGFAAQNISIAQATMFPHVIADVRVLEPIEVPLEDVRNVLFHNND-SSPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFLFLVPP--NVEQKTKP---FSVPNLPLNTLSNSRVPSLINAMMISRDHGQMVQFQNGRVTLDGQLQGTTPTSLSQLCKIRGKVFH
DSQ  ATGATGGCGTCTAAGGAC------------------------GCCCCAACAAACATGGATGGCACCAGTGGTGCCGGCCAGCTGGTACCAGAGGCAAACACA---GCTGAGCCTATTTCAATGGAGCCAGTGGCTGGGGCTGCGACAGCAGCCGCAACTGCTGGACAAGTAAATATGATTGAC---------CCCTGGATAATGAGTAATTATGTACAAGCTCCTCAAGGAGAATTTACCATATCGCCCAACAATACACCCGGTGACATTTTATTTGACCTGCAATTGGGCCCACACCTCAATCCTTTCTTGTCCCATTTAGCTCAAATGTACAATGGTTGGGTTGGAAATATGAGAGTGAAGGTGCTTTTGGCTGGTAATGCTTTTACAGCTGGGAAAATTATAATTAGTTGCATACCCCCTGGCTTTGCTGCGCAAAATATTTCCATAGCTCAAGCTACAATGTTCCCCCATGTCATTGCAGATGTTAGGGTGCTTGAACCTATAGAGGTCCCTCTTGAAGATGTTAGAAATGTGCTTTTCCACAATAATGAT---AGTTCCCCCACTATGAGATTGGTCTGCATGTTGTATACACCTCTTAGGGCTAGTGGTAGTTCTTCAGGCACTGACCCATTTGTCATTGCAGGAAGGGTCCTGACTTGCCCGAGCCCAGATTTTAGTTTCTTATTTCTTGTCCCCCCG------AATGTAGAACAGAAAACTAAGCCC---------TTTTCTGTGCCCAACTTGCCACTAAATACACTCTCTAACTCAAGGGTTCCTTCACTCATCAATGCTATGATGATTTCTAGAGACCATGGGCAGATGGTGCAGTTCCAAAATGGCAGAGTCACGCTTGATGGCCAGTTGCAGGGTACAACCCCTACTTCACTGAGCCAGCTATGCAAGATTAGAGGGAAAGTCTTCCAT
TRN  10010101100011000
NAM  Q66296_9CALI/2-292
ASQ  KMASND--------AAPSNDGAAC---LVPEIN--NEAMALEPVAGSAIAAPLTGQQNIID---PWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGGFEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPINLPMPDVRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGD--DVFTVSCRVLTRPSPDFSFNFLVPP--TVESKTKP---FTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTTQLLPSQICAFRGTLTR
DSQ  AAGATGGCGTCGAATGAC------------------------GCTGCTCCATCTAATGATGGTGCCGCCTGC---------CTCGTCCCAGAGATCAAC------AATGAGGCAATGGCGCTAGAGCCAGTGGCCGGTTCAGCGATAGCAGCTCCCCTCACTGGCCAGCAAAATATAATTGAT---------CCCTGGATTATGAATAATTTTGTACAAGCACCTGGTGGTGAGTTTACAGTGTCACCCAGGAATTCCCCTGGTGAAGTGCTTCTTAACTTGGAGTTAGGTCCAGAAATAAATCCTTATTTGGCTCATCTCGCTAGAATGTACAATGGTTATGCAGGTGGATTTGAAGTGCAAGTGGTCCTAGCTGGAAATGCGTTTACAGCAGGAAAGATTATCTTTGCAGCTATACCCCCTAACTTCCCTATTGACAATCTGAGCGCGGCACAGATCACAATGTGCCCGCATGTGATTGTGGATGTCAGGCAGTTGGAACCAATCAATCTCCCGATGCCTGATGTCCGCAACAATTTCTTTCATTACAATCAAGGTTCTGATTCAAGATTACGTTTGATTGCAATGCTGTATACACCTCTTAGGGCAAATAATTCTGGAGAT------GATGTTTTCACTGTGTCTTGCAGGGTGTTAACTAGGCCTAGCCCTGATTTCTCATTCAATTTTCTTGTCCCACCC------ACTGTGGAATCAAAGACAAAACCT---------TTCACCCTCCCCATTTTAACCATCTCTGAAATGTCTAATTCCAGGTTTCCGGTGCCAATTGACTCTCTGCACACCAGCCCAACTGAGAATATAGTTGTCCAGTGCCAAAATGGGCGCGTCACTCTTGACGGTGAGTTGATGGGCACCACCCAACTCTTACCGAGCCAAATATGTGCTTTCAGGGGCACACTCACTAGA
TRN  10010101100011000
NAM  O12305_9CALI/2-292
ASQ  KMASND--------AAPSTDGAAG---LVPESN--NEVMALEPVAGAALAAPVTGQTNIID---PWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGGMEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPDVRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGD--DVFTVSCRVLTRPSPDFDFTYLVPP--TVESKTKP---FTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTA
DSQ  AAGATGGCGTCGAATGAC------------------------GCCGCTCCATCTACTGATGGTGCAGCCGGC---------CTCGTGCCAGAAAGTAAT------AATGAGGTCATGGCTCTTGAGCCCGTGGCTGGTGCTGCCTTGGCAGCCCCGGTCACCGGTCAAACAAATATTATAGAC---------CCTTGGATTAGAGCAAATTTTGTCCAGGCCCCTAATGGTGAATTTACAGTTTCTCCCCGTAATGCCCCTGGTGAAGTGCTATTAAATCTAGAATTGGGTCCAGAATTAAATCCTTATCTGGCACATTTAGCAAGAATGTACAACGGGTATGCCGGTGGGATGGAGGTGCAGGTCATGCTAGCTGGGAACGCGTTCACAGCTGGCAAATTGGTCTTCGCTGCTGTACCACCTCATTTCCCGGTTGAAAACCTTAGTCCACAGCAAATTACCATGTTCCCTCATGTGATTATAGATGTTAGGACTTTGGAACCTGTTTTATTGCCACTCCCCGATGTTAGAAATAATTTCTTCCATTATAATCAAAAAGATGATCCTAAGATGAGAATTGTGGCTATGCTTTATACTCCCCTCAGGTCCAATGGTTCTGGTGAT------GATGTGTTCACAGTCTCTTGCAGGGTGTTGACTAGACCCTCCCCTGATTTTGATTTTACATACCTGGTACCACCA------ACAGTGGAATCCAAAACAAAACCA---------TTCACCCTTCCAATTCTTACACTTGGGGAGCTTTCCAATTCTAGATTTCCAGTGTCCATAGATCAGATGTACACTAGCCCCAATGAAGTCATATCTGTGCAGTGCCAGAATGGAAGGTGCACACTGGATGGGGAGCTCCAAGGAACAACACAGCTCCAAGTTAGTGGCATTTGTGCATTCAAAGGAGAAGTGACCGCT
TRN  10010101100011010
NAM  COAT_LORDV/2-292
ASQ  KMASND--------ANPSDGSAAN---LVPEVN--NEVMALEPVVGAAIAAPVAGQQNVID---PWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGGFEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPDVRNNFYHYNQANDSTLKLIAMLYTPLRANNAGD--DVFTVSCRVLTRPSPDFDFIFLVPP--TVESRTKP---FTVPVLTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTH
DSQ  AAGATGGCGTCGAATGAC------------------------GCCAACCCATCTGATGGGTCCGCAGCCAAC---------CTCGTCCCAGAGGTCAAT------AATGAGGTTATGGCTCTGGAGCCCGTTGTTGGTGCCGCTATTGCGGCACCTGTGGCGGGCCAACAAAACGTAATTGAC---------CCCTGGATTAGAAACAATTTTGTACAAGCCCCTGGTGGAGAGTTCACAGTGTCCCCTAGAAACGCTCCAGGTGAGATACTGTGGAGCGCGCCCTTGGGCCCTGATCTGAACCCCTATCTTTCTCATTTGTCCAGAATGTACAATGGTTATGCAGGTGGTTTTGAAGTGCAAGTAATCCTCGCGGGGAATGCGTTCACCGCCGGGAAAGTCATATTTGCAGCAGTCCCACCAAACTTTCCTACTGAAGGCTTAAGCCCCAGCCAGGTTACTATGTTCCCCCATATAATTGTAGATGTTAGACAATTGGAACCTGTGTTGATCCCCCTACCTGATGTTAGGAATAATTTCTATCATTACAATCAAGCAAATGATTCTACCCTCAAGTTGATAGCAATGTTGTACACACCACTCAGAGCTAATAATGCCGGGGAT------GATGTCTTCACAGTCTCTTGTCGAGTCCTCACGAGGCCATCCCCCGATTTTGATTTTATATTTCTGGTGCCACCC------ACAGTTGAATCAAGAACTAAACCA---------TTCACTGTCCCAGTCTTGACTGTTGAGGAAATGTCTAATTCAAGATTCCCCATTCCTTTGGAAAAGCTTTACACGGGCCCTAGTAGTGCTTTTGTTGTCCAACCACAAAATGGCAGATGTACGACTGATGGCGTACTTCTAGGCACTACCCAGCTGTCAGCTGTTAATATCTGTAACTTTAGGGGGGATGTTACCCAT
TRN  10010101100011000
NAM  POLN_RHDV/1768-2066
ASQ  GKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETWRTNFYYNDVFTWSVADAP---GSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVRAVIPP--GIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGS---TSAIQVTVETRPSEDFEFVMIRAPSSKTVDSISPAGLLTTPVLTGVGNDN-RWNGQIVGLQPVP---GGFSTCNRHWNLNGSTYG---WSSPRFGDIDHRRGS
DSQ  GGCAAAGCCCGTGCAGCGCCGCAAGGCGAAGCAGCGGGCACTGCCACCACAGCATCAGTTCCCGGAACCACGACTGATGGCATGGATCCTGGCGTTGTGGCCACTACCAGCGTGATCACTGCAGAAAATTCATCCGCATCGATTGCAACAGCAGGGATTGGCGGACCACCCCAACAGGTGGACCAACAAGAGACATGGAGAACAAATTTTTATTACAATGATGTTTTCACTTGGTCAGTCGCGGACGCCCCT---------GGCAGCATACTTTACACCGTCCAACATTCTCCACAAAACAACCCATTCACAGCCGTGCTGAGCCAGATGTACGCTGGCTGGGCTGGTGGCATGCAGTTTCGCTTCATAGTTGCCGGGTCAGGTGTGTTTGGTGGGCGACTGGTCCGGGCTGTGATACCACCA------GGCATCGAGATTGGACCAGGGTTGGAGGTTAGGCAGTTTCCTCATGTTGTCATCGATGCCCGTTCACTCGAACCTGTTACCATCACCATGCCAGACTTGCGTCCCAACATGTACCATCCAACTGGTGACCCTGGCCTTGTTCCCACACTAGTCCTTAGTGTTTACAACAACCTTATCAACCCGTTTGGTGGGTCC---------ACTAGTGCAATCCAGGTGACAGTGGAAACAAGGCCAAGTGAAGACTTTGAGTTCGTGATGATTCGAGCCCCCTCCAGCAAGACTGTTGACTCAATTTCGCCCGCAGGCCTCCTCACGACCCCAGTCCTTACTGGGGTTGGCAATGACAAC---AGGTGGAACGGCCAAATAGTGGGACTGCAACCAGTACCT---------GGAGGGTTTTCTACGTGCAACAGGCATTGGAACTTGAATGGCAGCACATATGGC---------TGGTCAAGCCCTCGGTTTGGCGACATTGACCATCGAAGAGGCAGT
TRN  10010101100011001
NAM  O09725_9CALI/267-561
ASQ  GNGSKLPTNQNGGHVGQDVDPPGATGPTTSHVVVSNPEQPNGPAQRLEMAVATGSIQSNVPE--AVRNCFAVCRTFAWNDRMPT---GTFLGSLSLHPNINPYTSHLSGMWAGWGGSFEARISISGSGMFAGRIIASVIPP--GVDPTSIRDPGVLPHAFVDARVTDPVSFMIPDVRNIDYHRMDITEPTCSLGFWVYQPLLNPFSTT--AVTTCWVSIETKPGGDFDFCLLRPPGQQMENGVSPE--GLLPRRLGYTRGN-RVGGLIVGMVLVAD---HRQ-VNRHFNARSITYG---WSTAPVNPMAAAIQT
DSQ  GGCAATGGCTCCAAATTGCCAACCAATCAAAATGGTGGCCATGTTGGCCAGGATGTTGACCCGCCTGGTGCGACTGGCCCGACCACATCCCATGTTGTTGTATCTAATCCAGAACAACCCAATGGGCCCGCGCAACGCCTGGAAATGGCTGTTGCTACTGGTTCCATCCAATCAAATGTCCCTGAA------GCGGTACGCAACTGCTTTGCAGTCTGCCGTACTTTTGCTTGGAATGACAGAATGCCCACT---------GGAACTTTTCTGGGATCTTTATCGCTTCATCCCAACATTAATCCATACACATCCCACCTTTCAGGTATGTGGGCAGGATGGGGAGGTAGTTTTGAAGCCCGCATCTCAATTTCTGGGTCTGGCATGTTTGCTGGGAGGATCATTGCTTCTGTCATACCACCT------GGGGTTGACCCCACGTCGATCAGGGATCCGGGCGTGCTTCCTCACGCTTTCGTTGATGCTCGTGTCACTGATCCAGTATCATTCATGATCCCTGATGTGAGGAACATTGATTACCATAGAATGGACATTACTGAACCCACTTGCTCCCTTGGTTTTTGGGTCTACCAACCATTGCTCAACCCGTTTTCCACCACA------GCAGTCACAACATGCTGGGTGTCCATTGAAACCAAACCTGGTGGTGATTTTGATTTCTGCCTTTTAAGGCCCCCTGGTCAACAGATGGAAAATGGTGTGTCACCTGAA------GGTCTCCTCCCACGCCGTTTGGGTTACACACGGGGGAAC---CGAGTTGGGGGGCTAATAGTTGGTATGGTTTTGGTTGCTGAC---------CACCGCCAG---GTGAACAGACATTTCAACGCACGGTCTATCACCTATGGG---------TGGTCTACTGCACCAGTTAATCCAATGGCAGCGGCAATCCAAACC
TRN  10010101100011000
NAM  COAT_SMSV1/137-427
ASQ  LQSTVD-TKPDF-VFRAESDGPGGADIVTEEQGT-VVQQQPVPAQSALTTLAAASTGKTVDC--EWTTFFSYHTAVNWSTTEAQ---GKILFSRALSPELNPYLRHISSLYSTWSGGIDVRFTVSGSGVFGGKLAALIVPP--GIEPVESPTMLQYPHVLFDARQTEPVIFTIPDIRKTLYHSMD-DTDTTRLVIMVYNELINP-YEQSEPKSSCSITVETRPSSDFTFSLLKPPGSLLKHGSIPS--DLIPRNSRHWMGN-RWWSTIDGFVVQP---RVFQ-SNRHFDFDSTTTG---WSTPYYIPIEVTLE-
DSQ  CTTCAGTCCACAGTAGAC---ACGAAGCCGGACTTC---GTGTTTAGGGCAGAATCGGACGGTCCTGGTGGAGCTGACATAGTGACTGAGGAACAAGGCACT---GTCGTTCAACAACAACCAGTGCCAGCACAATCTGCTCTGACAACCCTTGCGGCGGCGTCAACTGGTAAAACGGTCGACTGC------GAGTGGACAACCTTCTTCTCGTACCACACCGCTGTGAATTGGTCAACAACTGAGGCTCAA---------GGGAAGATTCTCTTCTCCCGAGCTCTGAGCCCTGAGCTGAATCCCTATCTTAGGCACATCTCATCTCTTTACTCTACCTGGTCTGGCGGGATTGATGTGAGGTTCACTGTGTCTGGATCTGGTGTCTTCGGCGGTAAGCTGGCCGCGTTAATAGTACCCCCT------GGTATTGAACCGGTGGAATCACCCACCATGCTTCAATATCCACACGTACTATTTGACGCTCGTCAGACTGAGCCGGTGATTTTCACCATCCCGGACATACGGAAGACACTCTACCACTCAATGGAT---GACACCGACACAACAAGACTTGTTATCATGGTTTACAACGAGCTCATAAACCCT---TATGAGCAATCTGAACCCAAGTCAAGCTGTTCCATCACCGTTGAGACTAGGCCCTCATCTGACTTCACATTTTCCCTACTCAAACCCCCAGGTTCCCTGTTGAAACACGGTTCAATCCCATCT------GATCTGATCCCAAGAAACTCGCGGCACTGGATGGGAAAT---CGTTGGTGGTCAACCATCGACGGTTTCGTTGTTCAGCCC---------CGCGTGTTCCAA---TCAAATAGGCACTTTGACTTTGACTCCACAACAACTGGT---------TGGTCAACCCCCTATTACATCCCAATTGAAGTGACACTTGAA---
TRN  10010101100011000
NAM  P89681_9CALI/137-422
ASQ  LRSTAD-VNSNF-TFRAESDGPGSTEIVTEEQGT-IVQQQPAPAPTALATLATASTGKSVEQ--EWMTFFSYHTSINWSTVESQ---GKVLYSQALNPSINPYLDHISKLYSTWSGGIDVRFTVSGSGVFGGKLAALLVPP--GVEPIESVSMLQYPHVLFDARQTEPVIFTIPDIRKTLFHSMD-ETDTTKLVIMVY----KNGADT---KTTCSITVETRPSADFTFALLKPPGSLIKHGSIPS--DLIPRNSAHWLGN-RWWSMISGFSVQP---RVFQ-SNRHFDFDSTTTG---WSTPYYIPIEITITA
DSQ  CTTCGGTCTACCGCGGAC---GTGAACAGCAACTTC---ACGTTCAGGGCTGAATCGGACGGTCCAGGCAGTACTGAAATTGTGACTGAGGAACAAGGTACC---ATTGTGCAGCAACAACCTGCACCCGCACCAACAGCATTAGCAACTCTTGCTACTGCTTCAACAGGGAAGTCTGTTGAACAA------GAGTGGATGACCTTCTTTTCCTATCACACATCTATCAACTGGTCTACAGTGGAATCTCAA---------GGAAAAGTGCTTTACTCACAGGCACTGAACCCCTCCATTAATCCATACCTTGATCACATAAGTAAATTGTACTCGACATGGTCTGGCGGCATCGATGTCCGGTTCACCGTCTCTGGATCTGGAGTGTTTGGCGGAAAACTTGCTGCACTCCTAGTCCCACCA------GGCGTTGAGCCCATCGAATCCGTATCCATGTTGCAGTACCCACACGTTCTATTTGACGCACGTCAAACGGAACCTGTGATCTTCACAATCCCTGACATTCGGAAAACTCTCTTCCACTCCATGGAT---GAGACTGACACAACCAAATTAGTGATCATGGTGTAC------------AAGAACGGGGCAGACACA---------AAAACCACTTGTTCCATCACTGTAGAGACCAGACCTTCTGCTGATTTCACCTTCGCTTTGCTGAAACCCCCTGGTTCTCTTATCAAGCATGGCTCTATCCCATCT------GATCTTATCCCCAGGAACTCTGCACACTGGCTAGGGAAC---CGCTGGTGGAGTATGATCTCTGGATTCTCTGTCCAACCT---------CGTGTCTTCCAG---TCAAACAGACACTTCGACTTTGATTCTACAACCACTGGC---------TGGTCAACACCCTATTACATACCAATTGAAATCACAATTACAGCA
TRN  10010101100011000
NAM  COAT_FCVC6/107-396
ASQ  ICKVAEGWDPNLPLFRLEAD---DGSITTPEQGT-MVGGVIAEPNAQMSTAADMATGKSVDS--EWEAFFSFHTSVNWSTSETQ---GKILFKQSLGPLLNPYLTHLAKLYVAWSGSVDVRFSISGSGVFGGKLAAIVVPP--GIDPVQSTSMLQYPHVLFDARQVEPVIFSIPDLRSTLYHLMS-DTDTTSLVIMVYNDLINP-YANDSNSSGCIVTVETKPGPDFKFHLLKPPGSMLTHGSIPS--DLIPKSSSLWIGN-RFWSDITDFVIRP---FVFQ-ANRHFDFNQETAG---WSTPRFRPITITIS-
DSQ  ATCTGTAAGGTTGCAGAAGGATGGGACCCAAACCTGCCACTTTTCCGCTTGGAAGCGGAC---------GATGGTTCCATCACGACACCTGAACAGGGAACA---ATGGTTGGTGGAGTCATTGCTGAGCCCAACGCCCAAATGTCAACCGCAGCTGACATGGCCACTGGGAAAAGTGTGGACTCT------GAGTGGGAAGCCTTCTTCTCCTTTCACACTAGTGTGAACTGGAGCACATCTGAAACTCAG---------GGGAAGATACTCTTTAAACAATCCTTAGGACCATTGCTCAACCCCTACCTTACCCATCTTGCAAAGCTGTATGTTGCTTGGTCTGGTTCTGTTGATGTTAGGTTTTCTATTTCTGGATCTGGTGTCTTTGGAGGGAAATTAGCTGCTATTGTTGTGCCGCCA------GGAATTGATCCTGTTCAAAGTACTTCAATGCTGCAATATCCTCATGTCCTCTTTGATGCTCGTCAAGTTGAACCTGTTATCTTTTCCATTCCCGATCTAAGAAGCACCTTATATCACCTTATGTCT---GACACTGATACCACATCGTTGGTAATCATGGTGTACAATGATCTTATTAACCCC---TATGCTAATGACTCAAACTCTTCGGGCTGCATTGTCACTGTGGAAACTAAACCGGGGCCAGATTTCAAGTTTCACCTCTTAAAACCTCCTGGGTCTATGTTAACTCACGGATCTATCCCATCT------GATCTAATCCCAAAATCATCTTCGCTTTGGATTGGAAAT---CGGTTTTGGTCTGACATAACCGATTTTGTAATTCGGCCT---------TTTGTGTTCCAG---GCAAATCGACACTTTGATTTCAACCAAGAGACAGCAGGT---------TGGAGCACCCCAAGGTTTCGCCCAATTACTATCACTATCAGT---
TRN  10010101100011000
//