EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00908 - dTDP_sugar_isom)
FAM  PF00908
PID  dTDP_sugar_isom
DES  dTDP-4-dehydrorhamnose 3,5-epimerase
IPR  IPR000888
ANO  19
ALN  185
AID  0.427134
APH  ((((((((((RFBC_SHIFL/3-177:0.16690,(RFBC_SALTY/4-179:0.14059,RFBC_ECOLI/3-178:0.32831):0.09626):0.07041,RFBC_NEIGO/3-176:0.35141):0.05754,(P74488_SYNY3/3-177:0.23657,Q56904_YEREN/3-184:0.48543):0.08506):0.07752,Q17993_CAEEL/15-190:0.65333):0.09907,(Q56809_XANCP/3-175:0.39238,O27818_METTH/6-176:0.33054):0.08110):0.17804,((P74831_9SPHN/4-180:0.36201,P96449_RHIME/4-180:0.28671):0.13477,RFBC_RHISN/11-186:0.38727):0.09585):0.03634,(P71436_LEPIN/3-180:0.41579,Q57502_YERPS/12-182:0.71184):0.13420):0.08175,(P72887_SYNY3/9-183:0.62339,Q54202_STRGA/3-177:0.44298):0.22641):0.54405,O06330_MYCTU/3-180:0.37366):0.08345,STRM_STRGR/1-175:0.40866,O33707_STRPE/3-179:0.60452);
ATP  ((((((((((RFBC_SHIFL/3-177,(RFBC_SALTY/4-179,RFBC_ECOLI/3-178)),RFBC_NEIGO/3-176),(P74488_SYNY3/3-177,Q56904_YEREN/3-184)),Q17993_CAEEL/15-190),(Q56809_XANCP/3-175,O27818_METTH/6-176)),((P74831_9SPHN/4-180,P96449_RHIME/4-180),RFBC_RHISN/11-186)),(P71436_LEPIN/3-180,Q57502_YERPS/12-182)),(P72887_SYNY3/9-183,Q54202_STRGA/3-177)),O06330_MYCTU/3-180),STRM_STRGR/1-175,O33707_STRPE/3-179);
ATL  9.81103
DNO  18
DLN  555
DID  0.484716
DPH  ((((((((((RFBC_SHIFL/3-177:0.20776,(RFBC_SALTY/4-179:0.16559,RFBC_ECOLI/3-178:0.34520):0.08340):0.05503,((P71436_LEPIN/3-180:0.34747,Q57502_YERPS/12-182:0.44037):0.13850,Q56904_YEREN/3-184:0.33381):0.10245):0.09583,P74488_SYNY3/3-177:0.32030):0.15283,RFBC_NEIGO/3-176:0.24146):0.13392,O27818_METTH/6-176:0.36798):0.09111,Q56809_XANCP/3-175:0.32833):0.11099,((P74831_9SPHN/4-180:0.24361,P96449_RHIME/4-180:0.24140):0.09349,RFBC_RHISN/11-186:0.37017):0.06805):0.09518,(Q54202_STRGA/3-177:0.32553,P72887_SYNY3/9-183:0.61129):0.09275):0.22056,O06330_MYCTU/3-180:0.30019):0.09316,STRM_STRGR/1-175:0.32843,O33707_STRPE/3-179:0.31264);
DTP  ((((((((((RFBC_SHIFL/3-177,(RFBC_SALTY/4-179,RFBC_ECOLI/3-178)),((P71436_LEPIN/3-180,Q57502_YERPS/12-182),Q56904_YEREN/3-184)),P74488_SYNY3/3-177),RFBC_NEIGO/3-176),O27818_METTH/6-176),Q56809_XANCP/3-175),((P74831_9SPHN/4-180,P96449_RHIME/4-180),RFBC_RHISN/11-186)),(Q54202_STRGA/3-177,P72887_SYNY3/9-183)),O06330_MYCTU/3-180),STRM_STRGR/1-175,O33707_STRPE/3-179);
DTL  7.40693
RID  0.429079
RPH  ((((((((RFBC_SHIFL/3-177:0.16153,(RFBC_SALTY/4-179:0.13587,RFBC_ECOLI/3-178:0.33415):0.10503):0.06017,(P74488_SYNY3/3-177:0.24345,Q56904_YEREN/3-184:0.46845):0.11074):0.06153,RFBC_NEIGO/3-176:0.33369):0.17343,(Q56809_XANCP/3-175:0.40013,O27818_METTH/6-176:0.32822):0.08986):0.14984,(RFBC_RHISN/11-186:0.40484,((P74831_9SPHN/4-180:0.36733,P96449_RHIME/4-180:0.28159):0.12203,(P72887_SYNY3/9-183:0.63014,Q54202_STRGA/3-177:0.44863):0.24616):0.06122):0.06859):0.06098,(P71436_LEPIN/3-180:0.40482,Q57502_YERPS/12-182:0.72147):0.10467):0.59760,O06330_MYCTU/3-180:0.35901):0.08715,O33707_STRPE/3-179:0.61356,STRM_STRGR/1-175:0.40615);
RTP  ((((((((RFBC_SHIFL/3-177,(RFBC_SALTY/4-179,RFBC_ECOLI/3-178)),(P74488_SYNY3/3-177,Q56904_YEREN/3-184)),RFBC_NEIGO/3-176),(Q56809_XANCP/3-175,O27818_METTH/6-176)),(RFBC_RHISN/11-186,((P74831_9SPHN/4-180,P96449_RHIME/4-180),(P72887_SYNY3/9-183,Q54202_STRGA/3-177)))),(P71436_LEPIN/3-180,Q57502_YERPS/12-182)),O06330_MYCTU/3-180),O33707_STRPE/3-179,STRM_STRGR/1-175);
RTL  9.13513
LNK  O06330_MYCTU/3-180:O06330:BX842583
LNK  O27818_METTH/6-176:O27818:AE000933
LNK  O33707_STRPE/3-179:O33707:AF006633
LNK  P71436_LEPIN/3-180:P71436:U61226
LNK  P72887_SYNY3/9-183:P72887:BA000022
LNK  P74488_SYNY3/3-177:P74488:BA000022
LNK  P74831_9SPHN/4-180:P74831:U51197
LNK  P96449_RHIME/4-180:P96449:Z79692
LNK  Q17993_CAEEL/15-190:Q17993:
LNK  Q54202_STRGA/3-177:Q54202:X89010
LNK  Q56809_XANCP/3-175:Q56809:AF204145
LNK  Q56904_YEREN/3-184:Q56904:Z18920
LNK  Q57502_YERPS/12-182:Q57502:L33181
LNK  RFBC_ECOLI/3-178:P37745:U03041
LNK  RFBC_NEIGO/3-176:P37763:Z32742
LNK  RFBC_RHISN/11-186:P55468:AE000075
LNK  RFBC_SALTY/4-179:P26394:X56793
LNK  RFBC_SHIFL/3-177:P37780:X71970
LNK  STRM_STRGR/1-175:P29783:X62567
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O33707_STRPE/3-179
ASQ  ARELAVQGAYTFEPEVFPDERGLFVSPFREDAFTAAVGHPLFPVRQTNHSRSRRGVVRGVHYTVTPPGSAKYVYCARGRSLDIVVDVRVGSPTYGRWDAVELEPREFRAVYFPVGVGHAFVALEDD.TVMSYMLSGEYVQANELAVSVLDPALGLPVP--GDLEP-...-LLSGRDRAAPPLEQA
DSQ  GCGCGGGAACTGGCGGTGCAGGGGGCGTACACGTTCGAGCCGGAGGTGTTTCCGGACGAGCGGGGGCTGTTCGTCTCACCGTTCCGGGAGGATGCGTTCACGGCCGCGGTCGGCCACCCCCTCTTCCCGGTGCGGCAGACGAATCACAGCCGGTCGCGGCGCGGGGTGGTGCGGGGCGTGCACTACACCGTGACGCCGCCGGGCTCGGCCAAGTACGTGTACTGCGCCCGTGGCAGGTCGCTGGACATCGTCGTCGACGTGCGGGTCGGCTCCCCGACGTACGGCCGGTGGGACGCCGTCGAGCTGGAGCCGCGTGAGTTCCGGGCGGTGTACTTCCCGGTCGGGGTGGGGCACGCCTTCGTGGCCCTGGAGGACGAC...ACCGTCATGTCGTACATGCTGTCCGGGGAGTACGTGCAGGCCAACGAACTCGCCGTGTCGGTGCTGGACCCGGCCCTCGGGCTGCCCGTGCCG------GGTGACCTGGAGCCT---.........---CTGCTGTCCGGCCGGGACCGGGCTGCACCGCCCCTGGAGCAGGCC
TRN  10010101100011001
NAM  STRM_STRGR/1-175
ASQ  MRPLSVQGAWLSETRAFADDRGEFQELYSARSLRGALGYDPG-VAQVNRSVSRRGVLRGVHFAQLPPSQAKYVTCLSGAVLDVVVDIRTGSPTYRAWEAVRLDDPHR-SLYVEAGLGHSFMALTDD.AVVVYLTSQGYAAGREHGVHPLDPDLGIAWP--DGIEP-...-VLSEKDRQAPGIAEM
DSQ  GTGCGCCCGCTCAGTGTGCAAGGGGCCTGGCTGTCGGAAACCCGTGCGTTCGCCGACGACCGAGGCGAGTTCCAGGAGCTGTACAGCGCCCGGTCGCTGCGCGGTGCGCTCGGCTACGACCCCGGG---GTCGCCCAGGTCAACCGGTCCGTCTCGCGGCGCGGGGTGCTGCGCGGGGTGCACTTCGCGCAGCTCCCGCCCAGCCAGGCCAAGTACGTCACGTGCCTCAGCGGGGCGGTGCTGGACGTGGTGGTGGACATCCGGACGGGCTCGCCCACCTACCGGGCCTGGGAGGCCGTCCGGCTGGACGACCCGCACCGC---AGTCTCTACGTCGAGGCCGGGCTCGGTCACTCCTTCATGGCCCTCACCGACGAC...GCCGTCGTCGTCTACCTCACCTCGCAGGGGTATGCCGCCGGCCGGGAGCACGGGGTGCACCCCCTCGACCCGGACCTCGGCATCGCCTGGCCC------GACGGCATCGAACCG---.........---GTGCTCTCCGAGAAGGACCGGCAGGCGCCGGGCATCGCGGAGATG
TRN  11011111101111111
NAM  O06330_MYCTU/3-180
ASQ  ARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLD-VRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDN.STVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAP-...-SLSDRDAAAPSFEDV
DSQ  GCACGCGAACTCGACGTCCCCGGCGCCTGGGAGATTACCCCGACCATCCATGTCGATTCCCGCGGACTGTTCTTCGAATGGCTTACCGATCATGGGTTCCGCGCATTCGCAGGTCACAGTTTGGAC---GTCCGGCAAGTGAACTGCTCGGTGTCATCGGCCGGTGTGCTGCGCGGCCTGCACTTTGCCCAGTTGCCGCCGAGCCAGGCCAAGTATGTGACCTGCGTTTCCGGCTCGGTGTTCGATGTCGTCGTCGACATCCGAGAGGGCTCACCGACATTCGGCCGATGGGACTCGGTGCTGCTCGACGACCAAGACCGTAGGACGATCTACGTCTCCGAAGGCCTAGCGCACGGCTTCCTTGCACTGCAAGACAAT...TCGACGGTGATGTACTTGTGCTCGGCGGAATACAATCCGCAGCGCGAGCACACCATCTGCGCCACAGATCCGACGTTGGCGGTCGATTGGCCGCTGGTCGATGGCGCTGCCCCC---.........---AGCCTGTCCGACCGTGATGCCGCTGCGCCCAGCTTCGAGGATGTG
TRN  10010101100011001
NAM  Q57502_YERPS/12-182
ASQ  FKKLDIEGCYLIEFNKFIDSRGTFVKTFHSDFFSENGIVL-DMREEFYSISAK-NVIRGMHFQMPPAEHDKLVYCVNGAVLDVILDIRKDSKTYGEYFSIELSYENSLALWVPKGLAHGFLSLADN.SIMFYKTSSVHNVECDSGIKWN--SFGFKWPIDN-----...PIISEKD-NSLCYFDE
DSQ  TTTAAAAAATTGGATATTGAGGGTTGTTACCTTATAGAATTTAATAAATTCATTGATTCCCGAGGAACGTTTGTAAAAACATTTCACTCGGACTTTTTTTCTGAGAATGGAATAGTTTTG---GATATGCGAGAGGAGTTTTATTCAATATCAGCTAAG---AATGTTATACGGGGTATGCATTTTCAAATGCCTCCAGCTGAACATGACAAACTCGTCTATTGTGTAAATGGAGCTGTTCTTGATGTTATCTTAGATATAAGAAAAGATTCTAAAACATATGGGGAGTATTTTAGTATTGAATTAAGTTATGAAAATAGCTTAGCACTATGGGTGCCAAAAGGTTTAGCCCATGGATTTTTATCACTTGCAGATAAT...TCAATAATGTTTTATAAAACAAGTTCTGTTCACAATGTTGAGTGTGATTCTGGTATTAAATGGAAT------TCATTTGGATTTAAATGGCCGATTGATAAT---------------.........CCAATTATATCTGAGAAAGAT---AATTCTCTTTGCTATTTTGATGAG
TRN  10010101110011000
NAM  Q54202_STRGA/3-177
ASQ  IHETPLAGAALIELSELRDERGFFSRSFCREEFERAGLEP-AVVQCNLSFNHRAGSLRGFHYQTEPNAEAKTIRCTRGAIYDVIVDLRPDSPTFLRHFGAELTADNRLALHVPRNFAHAYLTLADD.TETVYQVSAAYTPGAERGLRWNDPALGVEWPAPVK-L--...--VSDKDAGWPLLSEV
DSQ  ATTCATGAAACTCCGCTGGCCGGCGCCGCTCTCATCGAACTGAGCGAATTGAGGGACGAAAGGGGGTTCTTCTCCCGCTCGTTCTGCCGGGAGGAGTTCGAGCGGGCGGGACTGGAGCCC---GCCGTGGTCCAGTGCAATCTCTCGTTCAACCACCGCGCCGGCAGCCTCCGCGGATTCCACTATCAGACGGAGCCGAACGCCGAGGCGAAGACGATTCGCTGCACGCGCGGCGCGATCTACGACGTGATCGTCGATCTGCGTCCCGACTCCCCCACGTTCCTGCGGCACTTCGGCGCGGAACTCACCGCCGACAACCGGCTCGCCCTGCACGTCCCCCGCAACTTCGCGCACGCGTACCTGACACTGGCCGACGAC...ACGGAGACGGTGTACCAGGTCTCCGCCGCCTACACCCCCGGCGCGGAAAGGGGTCTGCGCTGGAACGATCCGGCGCTCGGGGTCGAGTGGCCGGCGCCGGTGAAG---CTG------.........------GTGTCGGACAAGGACGCCGGCTGGCCGCTGCTGTCCGAGGTG
TRN  10010101100011011
NAM  P72887_SYNY3/9-183
ASQ  TEDLGIAGLRTVIRQPIGDRRGFLARLFCAEELKEVGWHK-PIAQINHTHTAQGGTVRGMHYQNPPSAEMKLVTCIRGQVWDVAVDLRVDSPTFLTWQGVVLSADNNRALLIPEGCAHGFQALSDD.VELIYCHSVAYNPMAEGGLNPQDPRLGIEWPQAIT-E--...--LSQRDQNHPLLDST
DSQ  ACTGAAGATTTGGGCATTGCCGGACTCAGAACCGTTATCCGTCAGCCCATCGGCGATCGCCGGGGATTTTTGGCCCGTTTGTTTTGTGCTGAGGAGTTGAAGGAAGTAGGTTGGCATAAA---CCCATTGCCCAGATTAACCATACCCATACGGCCCAAGGCGGCACTGTGCGAGGTATGCATTACCAAAATCCTCCCTCTGCGGAAATGAAATTGGTTACTTGCATTCGGGGTCAGGTTTGGGATGTGGCGGTGGATTTGCGGGTTGATTCCCCCACTTTTTTGACTTGGCAAGGGGTAGTACTAAGTGCGGATAACAATAGGGCATTGTTGATACCCGAAGGCTGTGCCCATGGTTTTCAAGCCTTGAGCGATGAT...GTTGAATTGATTTACTGTCACTCGGTCGCCTATAACCCGATGGCGGAAGGGGGGTTGAATCCCCAAGATCCTCGCCTAGGGATTGAGTGGCCCCAAGCAATTACC---GAA------.........------TTATCCCAGCGAGACCAAAATCACCCCTTACTAGATTCCACC
TRN  10010101110011010
NAM  Q17993_CAEEL/15-190
ASQ  EVIEAIPDLLVIKPKVFPDERGFFSESYNKTEWAEKIGYTEDLQQDNHSFSHY-GVLRGLHTQPHM---GKLVTVVSGEIFDVAVDIRKDSPTYGKWHGVVLNGDNKHAFWIPAGFLHGFQVLSKEgAHVTYKCSAVYDPKTEFGINPFDEDINVDWPIRDKTVVI...--VSERDTQHASFKSL
NAM  Q56904_YEREN/3-184
ASQ  CTKLSIPEVILFEPRIFEDDRGHFFESFNLAKFQESIGRQVTFVQSNESYSKQ-NVIRGLHYQVIR-PQGKLVRVVEGEVFDIAVDLRKSSPTFGQWVGVLLSDKNNHQLWIPEGFGHGFQVLSPS.AKFQYMVTDYWYPEHDRCIRFNDSDINIKWKEGIISEQQvieYKLSSKDISGNSLADA
DSQ  TGTACAAAACTATCTATTCCTGAAGTGATTTTGTTCGAACCTCGTATTTTTGAAGATGATCGCGGACATTTTTTTGAAAGTTTCAATCTGGCGAAATTTCAAGAATCAATTGGACGTCAGGTAACATTTGTACAATCTAATGAGTCGTATTCGAAGCAA---AATGTTATTCGGGGGCTGCATTATCAAGTTATTCGC---CCTCAAGGGAAATTAGTGAGAGTCGTTGAGGGTGAGGTTTTTGATATTGCTGTAGATTTGCGTAAATCTTCACCAACTTTTGGGCAATGGGTAGGTGTGCTCCTATCTGACAAAAATAATCATCAACTCTGGATTCCTGAAGGTTTCGGCCACGGATTCCAAGTTCTGTCACCATCA...GCTAAATTCCAATATATGGTTACTGATTATTGGTACCCTGAGCATGATCGATGTATTCGTTTTAATGACTCTGATATAAATATAAAATGGAAAGAGGGGATTATATCCGAACAGCAAgttattgagTACAAACTATCGAGTAAAGATATTTCTGGTAATTCTTTAGCTGATGCT
TRN  10010101100011000
NAM  RFBC_ECOLI/3-178
ASQ  VIRTEIEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRSSK-NVLRGLHFQRGEYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHGFLVLSDI.AEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLILS...---P-KDERLFTLDEL
DSQ  GTGATTAGAACTGAAATTGAAGATGTGCTAATTCTGGAGCCAAGAGTATTTGGTGATGATAGAGGTTTCTTTTATGAGAGCTTTAATCAATCAGCATTTGAACATATTCTAGGCTATCCGGTCAGCTTTGTTCAAGACAATCACTCACGTTCATCAAAA---AATGTACTCAGAGGCCTTCACTTTCAACGCGGCGAGTACGCACAAGATAAACTTGTACGCTGCACTCATGGAGCAGTTTTTGATGTTGCTGTTGATATTCGACCCAATTCGGTATCCTTTGGTAAATGGGTTGGTGTTCTGCTTTCAGCTGATAATAAGCAGCAGTTGTGGATACCAAAAGGGTTTGCTCATGGCTTTTTGGTTCTGTCTGATATC...GCTGAATTTCAATATAAAACTACAAACTATTATCATCCTGAAAGCGATTGTGGAATATGTTGGAATGATGAACGCATTGCAATTGATTGGCCCCAAACATCAGGGTTAATCCTTTCG.........---------CCA---AAAGATGAAAGGCTCTTTACGTTAGATGAGCTT
TRN  10010101100011000
NAM  RFBC_SALTY/4-179
ASQ  VIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKK-NVLRGLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSEY.AEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELS...---A-KDAAAPLLDQA
DSQ  GTGATTAAAACAGCAATACCAGATGTCTTGATCTTAGAGCCTAAAGTTTTTGGCGATGAGAGGGGATTCTTTTTTGAAAGTTATAACCAGCAGACCTTTGAAGAGTTGATTGGACGTAAAGTTACATTTGTTCAAGATAATCATTCAAAATCCAAAAAG---AACGTACTCAGAGGGCTACATTTTCAGAGAGGAGAAAATGCACAGGGGAAGTTAGTTCGTTGTGCTGTCGGTGAGGTTTTTGATGTTGCGGTCGATATCCGAAAAGAATCGCCTACTTTTGGTCAATGGGTTGGTGTAAATCTGTCTGCTGAGAATAAGCGACAGCTTTGGATTCCAGAAGGTTTTGCTCATGGTTTTGTTACTCTTAGTGAGTAT...GCAGAGTTTCTGTACAAAGCAACTAATTATTACTCACCTTCATCGGAAGGTAGCATTCTATGGAATGATGAGGCAATAGGTATTGAATGGCCTTTTTCTCAGCTGCCTGAGCTTTCA.........---------GCA---AAAGATGCTGCAGCACCTTTACTGGATCAAGCC
TRN  10010101100011000
NAM  RFBC_SHIFL/3-177
ASQ  VIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTK-GVLRGLHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFCVLSDE.AEFVYKTNNFYSKMQERGILWSDKSINIEWPVQN-PLLS...---D-KDINGQKFVDA
DSQ  GTAATTAAAACTGAAATTCCTGATGTGCTAATTTTTGAACCAAAAGTATTTGGTGATGAGCGGGGCTTTTTTATGGAAAGCTTCAATCAGAAAGTTTTCGAAGAGGCTGTAGGACGAAAGGTTGAGTTTGTTCAGGATAACCATTCTAAATCAACTAAG---GGTGTGTTACGCGGACTGCACTATCAGCTGGAACCTTATGCTCAAGGAAAACTGGTACGCTGTGTTGTCGGTGAAGTTTTTGACGTAGCTGTTGATATTCGGAAATCATCACCAACATTTGGCAAGTGGGTTGGTGTAAATTTGTCGGCGGAGAATAAGCGTCAATTATGGATACCGGAAGGATTCGCTCATGGGTTTTGCGTTCTTAGTGATGAA...GCAGAATTTGTCTACAAAACAAATAATTTCTATTCAAAAATGCAAGAGCGTGGGATTTTATGGAGCGACAAAAGTATAAATATAGAATGGCCGGTTCAAAAT---CCATTGCTTTCT.........---------GAT---AAAGATATTAATGGTCAAAAATTTGTAGATGCT
TRN  10010101100011000
NAM  P74488_SYNY3/3-177
ASQ  VIPTTIADVLILEPKVFGDERGFFFESYNDKVFQQAVGIEPHFVQDNHSFSRQ-GVVRGLHYQIQH-PQGKLVRVARGEIFDVAVDLRRNSPSFGQWVGCVLNDHNKRQLWIPAGFAHGFAVLSPE.AEVLYKATDYYAPSYERTLLWNDPAIGIDWSLTTTPL--...--LSLKDQRGLPLAEA
DSQ  GTGATTCCCACAACTATCGCCGATGTGTTGATTTTGGAGCCCAAAGTCTTTGGCGATGAACGGGGTTTTTTCTTTGAGAGCTACAACGACAAGGTTTTCCAGCAGGCAGTGGGCATAGAACCCCATTTTGTGCAGGACAATCATTCCTTTTCTCGTCAG---GGGGTAGTGCGGGGGTTACATTATCAAATCCAGCAT---CCCCAGGGAAAATTAGTTCGGGTGGCCCGGGGAGAAATTTTTGATGTGGCAGTGGATCTGCGCCGTAATTCCCCTAGTTTTGGCCAGTGGGTGGGTTGTGTGCTCAATGACCACAATAAAAGACAGCTATGGATTCCCGCCGGTTTTGCCCACGGTTTCGCCGTTCTTTCCCCGGAG...GCAGAGGTGCTGTATAAAGCAACGGATTACTATGCACCGTCCTATGAGCGCACCCTATTGTGGAATGACCCGGCCATTGGCATTGATTGGTCGTTAACCACCACTCCCCTA------.........------TTATCTCTCAAGGATCAACGGGGTCTTCCCCTAGCCGAAGCG
TRN  10010101100011010
NAM  RFBC_NEIGO/3-176
ASQ  IIDTALPDVKLLKPQVFTDGRGFFMETFRDGWFKENIADR-TFVQENHSNSSK-GVLRGLHYQTEN-TQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNRYQLWIPEGFAHGFCVLGDA.AEVVYKCTDYYNPETEQVLIWNDPAIGIGWPLQTAPL--...--LSPKDLAGKTWAQA
DSQ  ATCATCGACACCGCCCTCCCCGACGTAAAACTTTTAAAACCGCAAGTCTTCACAGACGGGCGCGGTTTTTTTATGGAAACATTCCGCGACGGATGGTTCAAAGAAAATATTGCCGATCGA---ACTTTCGTGCAGGAAAACCACTCCAACTCCAGCAAG---GGCGTATTGCGCGGCCTGCACTACCAAACCGAAAAC---ACCCAAGGCAAACTCGTACGCGTAGTTGTCGGCGAAGTGTTCGACGTGGCCGTCGATATGCGCGAAGGTTCGCCGACTTTCGGCAAATGGGCGGGCGCAACCTTGTCGGCGCAAAACCGATACCAGCTTTGGATACCCGAAGGCTTCGCACACGGTTTTTGCGTTTTGGGCGACGCG...GCGGAAGTCGTGTACAAATGCACGGACTATTACAACCCTGAAACCGAACAGGTTTTAATATGGAACGACCCGGCAATCGGCATAGGCTGGCCGCTTCAAACCGCGCCGCTG------.........------CTTTCGCCCAAAGACCTTGCCGGCAAAACGTGGGCACAAGCC
TRN  10010101100011010
NAM  O27818_METTH/6-176
ASQ  FIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEV-RFVQDNESMSVR-GVLRGLHFQREK-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDE.CIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLI...--ISEKDR-----NWK
DSQ  TTCATAAAAACCAGCCTTGATGGTGCCATAATCATAGAACCCGAGGTGTACACGGACGAGAGAGGATACTTCATGGAGACATTCAATGAGGCCATATTCCAGGAAAATGGCCTTGAAGTC---AGGTTTGTGCAGGACAACGAGTCTATGTCAGTTAGG---GGTGTCCTCAGGGGACTGCACTTCCAGAGAGAAAAG---CCCCAGGGAAAACTTGTGAGGGTTATAAGGGGCGAAATCTTTGATGTTGCAGTGGACCTCAGGAAGAACTCAGATACCTATGGTGAATGGACTGGCGTCAGGCTCTCAGATGAGAACAGAAGGGAGTTTTTCATCCCAGAGGGCTTTGCACATGGATTCCTGGCCCTCTCAGATGAG...TGCATAGTTAACTACAAATGCACCGAGCTTTACCACCCTGAATATGACTCAGGGATCCCCTGGGACGACCCTGACATTGGAATAGACTGGCCACTTGAAATGGTGGATGATCTGATA.........------ATCTCAGAGAAGGACAGA---------------AACTGGAAA
TRN  10010101100011001
NAM  Q56809_XANCP/3-175
ASQ  VIETTLPGCVVIEPAVFGDERGQFFETWNAERFGQHGLPT-SFVQSNVSTSAR-GVLRGLHYQWPR-PQGKLVSVLEGEVYDVAVDIRAGSPHFGRWTAVLLSAENRRQVWIPEGFAHGFAVLSEK.ALFSYLCTDVYVKEADAGVRWDDAAIGIDWPVSD-----...PSLSAKDAKAPFLDEV
DSQ  GTGATCGAAACGACGTTGCCCGGCTGCGTCGTCATCGAGCCTGCGGTCTTCGGTGATGAGCGCGGTCAGTTCTTCGAAACATGGAATGCGGAGCGCTTTGGGCAGCACGGCCTGCCGACG---AGTTTTGTGCAAAGTAACGTCTCCACGTCCGCCAGG---GGCGTGCTACGTGGTCTGCACTATCAGTGGCCTCGA---CCGCAGGGCAAATTGGTGAGCGTGCTTGAAGGCGAGGTGTACGATGTCGCGGTGGATATCCGCGCTGGGTCTCCCCACTTCGGGCGTTGGACCGCTGTTTTACTGAGCGCAGAAAATCGACGCCAAGTCTGGATACCTGAAGGCTTTGCACATGGTTTCGCAGTACTTTCAGAGAAA...GCATTGTTCAGCTATCTGTGCACCGATGTGTACGTCAAGGAAGCGGATGCAGGCGTGCGTTGGGACGATGCGGCGATCGGGATCGATTGGCCGGTCAGCGAT---------------.........CCGTCGCTGTCCGCCAAGGATGCCAAGGCGCCGTTCCTGGATGAGGTG
TRN  10010101100011000
NAM  RFBC_RHISN/11-186
ASQ  FQSLSIAEVKLIRPRKFGDCRGYFSEVFREKWFRKNVADV-GLVQDNESLSAQIGTVRGLHFQLEPFAQGKLVRCTRGALFDVAVDVRVGSPTYGKWVSAELSQENGAQLWVPAGFAHGFMTLKAD.TVISYKVTAPYSAEHDRGLKWDDPAIGINWPKMTT----...YVLSEKDSSQPSLCEL
DSQ  TTTCAAAGCCTGTCGATAGCCGAAGTCAAGTTAATTAGGCCTAGGAAGTTTGGCGATTGCCGCGGCTATTTCAGCGAAGTATTCAGGGAAAAATGGTTCCGCAAAAATGTTGCCGATGTC---GGACTTGTTCAGGATAATGAATCACTCTCCGCTCAGATCGGGACGGTAAGGGGCCTTCACTTTCAGCTCGAGCCTTTCGCGCAAGGAAAGCTTGTCCGCTGTACACGCGGCGCGCTGTTCGACGTCGCGGTGGACGTCAGGGTCGGGTCACCAACATACGGGAAATGGGTTTCCGCCGAGCTATCTCAGGAAAATGGCGCGCAGCTTTGGGTTCCTGCGGGCTTCGCGCATGGTTTCATGACGCTTAAGGCGGAC...ACGGTAATCAGCTACAAGGTGACAGCGCCCTATAGCGCTGAACATGATCGCGGACTGAAATGGGACGATCCCGCCATCGGAATCAATTGGCCAAAGATGACCACG------------.........TACGTTCTGTCGGAAAAGGACTCCAGTCAGCCATCACTCTGCGAACTT
TRN  10010101100011000
NAM  P96449_RHIME/4-180
ASQ  VRSLGLDGVLEIVPRRLGDERGFFSETYNAETLAAHGVAA-IFVQDNHSYSAAAGTLRGLHYQLPPKAQAKLVRVVRGRVFDVVVDIRKGSPTFAKWVALELSAEKWNQILVPVGFAHGLVTLDPE.TEVLYKVSEHYSAEHERSIRYDDPEIGIGWPAATDR---...LQLSAKDRNAPLLHES
DSQ  GTCAGGTCCCTGGGCCTCGACGGGGTTCTGGAAATCGTTCCGCGCAGACTCGGCGACGAGCGCGGCTTCTTTTCGGAGACCTACAATGCGGAGACCCTCGCCGCCCACGGCGTCGCGGCG---ATCTTCGTACAGGACAACCATTCCTATTCCGCGGCTGCGGGCACGCTGCGCGGCCTGCACTATCAGCTTCCGCCCAAGGCGCAGGCGAAGCTCGTTCGCGTTGTTCGAGGCCGGGTGTTCGATGTCGTGGTCGACATTCGCAAGGGTTCGCCGACCTTCGCGAAATGGGTCGCTCTCGAACTCTCGGCGGAGAAATGGAACCAGATTCTGGTGCCTGTCGGCTTCGCCCACGGCCTCGTGACGCTCGATCCGGAA...ACGGAAGTTCTCTACAAGGTAAGCGAGCATTACAGCGCTGAGCATGAGCGGTCCATCCGCTACGACGATCCTGAGATCGGCATAGGCTGGCCTGCCGCTACCGACCGT---------.........CTGCAACTGTCCGCGAAGGACAGGAACGCACCACTGCTCCACGAATCC
TRN  10010101100011011
NAM  P74831_9SPHN/4-180
ASQ  VHHHALSGVIEFTPPKYGDHRGFFSEVFKQSTLDAEGVEA-RWVQDNQSFSAAPGTIRGLHLQAPPFAQAKLVRVLRGAIYDVAVDIRRGSPTYGQWVGVELSADKWNQLLVPAGYAHGFMTLVPD.CEILYKVSAKYSKESEMAIRWDDPDLAITWPDIGVE---...PVLSEKDAVATPFAEF
DSQ  GTGCATCACCACGCGCTATCGGGCGTCATCGAGTTCACCCCGCCCAAGTACGGCGATCACCGCGGCTTCTTCTCCGAGGTGTTCAAGCAGTCCACGCTCGACGCCGAAGGCGTCGAGGCG---CGGTGGGTGCAGGACAATCAGAGCTTCTCGGCCGCACCGGGCACGATCCGCGGACTGCACCTGCAGGCGCCGCCCTTCGCCCAGGCCAAGCTGGTGCGCGTGCTGCGCGGCGCGATCTACGACGTCGCGGTCGACATTCGCCGCGGCTCGCCCACATACGGCCAGTGGGTCGGCGTCGAGCTTTCGGCGGACAAGTGGAACCAGCTGCTGGTGCCGGCCGGCTATGCGCATGGCTTCATGACGCTCGTCCCGGAT...TGCGAGATCCTCTACAAGGTCAGCGCCAAATATTCGAAGGAATCGGAGATGGCGATCCGCTGGGATGATCCCGATCTCGCCATCACCTGGCCGGACATCGGCGTCGAG---------.........CCGGTGCTCTCCGAAAAGGACGCGGTCGCTACCCCGTTCGCCGAATTC
TRN  11011101101011011
NAM  P71436_LEPIN/3-180
ASQ  FKKFQIEGPVLIEPKVFGDERGFFLETFKASIFEKENIPF-QFSQDNHSRSSR-GVLRGMHLQIPPYDQGKLVRVVRGKVIDVVVDVRVGSPNYGKWLSVELSEENKNIFWVPPGFAHGFLTLEDK.TDFLYKVTGEYSPQNEVGIRWDDPALGIPWKTWLSDSE-...FIVSQRDQVTPFFADF
DSQ  TTTAAAAAATTTCAGATAGAAGGTCCAGTTTTAATTGAACCTAAAGTTTTTGGAGATGAAAGAGGTTTTTTTTTGGAAACCTTTAAGGCATCTATTTTCGAAAAAGAAAACATACCATTT---CAATTTTCCCAAGACAATCATTCTAGATCTTCTCGA---GGGGTATTGAGGGGGATGCATCTGCAAATTCCTCCTTACGATCAAGGAAAGTTAGTCCGAGTAGTGAGAGGTAAGGTGATAGATGTGGTGGTAGACGTTAGGGTAGGTTCCCCCAATTATGGAAAATGGCTTTCCGTGGAATTATCTGAAGAAAATAAAAATATATTTTGGGTTCCTCCTGGATTTGCTCATGGATTTTTAACCTTAGAAGATAAA...ACAGATTTTTTATATAAAGTGACCGGAGAATACAGTCCTCAGAATGAGGTAGGAATTCGTTGGGATGATCCTGCGTTAGGTATTCCTTGGAAGACATGGTTGTCTGATTCTGAA---.........TTTATAGTATCTCAGAGGGACCAAGTGACTCCTTTTTTTGCAGACTTT
TRN  10010101100011010
//