EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00836 - Stathmin)
FAM  PF00836
PID  Stathmin
DES  Stathmin family
IPR  IPR000956
ANO  4
ALN  140
AID  0.713868
APH  (STMN1_HUMAN/3-142:0.06592,STM1A_XENLA/4-143:0.16305,(STMN4_RAT/48-187:0.19486,STMN2_HUMAN/38-177:0.21593):0.10905);
ATP  (STMN1_HUMAN/3-142,STM1A_XENLA/4-143,(STMN4_RAT/48-187,STMN2_HUMAN/38-177));
ATL  0.74881
DNO  4
DLN  420
DID  0.679762
DPH  (STMN1_HUMAN/3-142:8.04784,STM1A_XENLA/4-143:18.55895,(STMN4_RAT/48-187:18.70195,STMN2_HUMAN/38-177:22.08355):12.92888);
DTP  (STMN1_HUMAN/3-142,STM1A_XENLA/4-143,(STMN4_RAT/48-187,STMN2_HUMAN/38-177));
DTL  80.337
RID  0.713868
RPH  (STMN1_HUMAN/3-142:0.06592,STM1A_XENLA/4-143:0.16305,(STMN4_RAT/48-187:0.19486,STMN2_HUMAN/38-177:0.21593):0.10905);
RTP  (STMN1_HUMAN/3-142,STM1A_XENLA/4-143,(STMN4_RAT/48-187,STMN2_HUMAN/38-177));
RTL  0.74881
LNK  STM1A_XENLA/4-143:Q09006:X71431
LNK  STMN1_HUMAN/3-142:P16949:J04991
LNK  STMN2_HUMAN/38-177:Q93045:CR456833
LNK  STMN4_RAT/48-187:P63043:AF026528
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  STMN1_HUMAN/3-142
ASQ  SDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPA
DSQ  TCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGCTGATTCTCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCCCATGAAGCTGAGGTCTTGAAGCAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAGTGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCAGTAAAATGGCAGAAGAGAAACTGACCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGCTGCCAAACTGGAACGTTTGCGAGAGAAGGATAAGCACATTGAAGAAGTGCGGAAGAACAAAGAATCCAAAGACCCTGCT
TRN  10010101100011000
NAM  STM1A_XENLA/4-143
ASQ  SDIKVKQLEKRASGQAFELILSPPSMDAAPDLSITSPKKKECSLEEIQKKLEAAEERRKLHEAEILKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTTKMETIKENREAQIAAKLERLREKDKKVEEIRKGKECKEPS
DSQ  TCTGATATTAAAGTAAAACAGCTGGAAAAGCGTGCTTCTGGTCAAGCATTTGAGCTAATCTTGAGTCCTCCATCTATGGATGCTGCACCAGACCTTTCCATTACTTCGCCCAAGAAGAAGGAATGCTCCTTGGAAGAAATTCAAAAGAAACTAGAAGCTGCAGAAGAAAGGCGCAAGTTGCATGAAGCTGAAATATTGAAGCAGCTTGCTGAAAAGAGAGAACATGAGAAGGAGGTCCTACAAAAGGCTATTGAAGAGAACAACAACTTCAGTAAAATGGCAGAAGAAAAGCTAACTACAAAAATGGAGACCATAAAAGAAAATAGAGAGGCTCAGATTGCTGCAAAGCTGGAAAGGTTGCGAGAGAAGGATAAAAAAGTGGAAGAAATCAGAAAGGGGAAAGAATGCAAAGAACCTTCT
TRN  10010101100011011
NAM  STMN2_HUMAN/38-177
ASQ  DDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVEL
DSQ  GATGATATGGAAGTGAAGCAAATCAACAAACGTGCCTCTGGCCAGGCTTTTGAGCTGATCTTGAAGCCACCATCTCCTATCTCAGAAGCCCCACGAACTTTAGCTTCTCCAAAGAAGAAAGACCTGTCCCTGGAGGAGATCCAGAAGAAACTGGAGGCTGCAGAGGAAAGAAGAAAGTCTCAGGAGGCCCAGGTGCTGAAACAATTGGCAGAGAAGAGGGAACACGAGCGAGAAGTCCTTCAGAAGGCTTTGGAGGAGAACAACAACTTCAGCAAGATGGCGGAGGAAAAGCTGATCCTGAAAATGGAACAAATTAAGGAAAACCGTGAGGCTAATCTAGCTGCTATTATTGAACGTCTGCAGGAAAAGGAGAGGCATGCTGCGGAGGTGCGCAGGAACAAGGAACTCCAGGTTGAACTG
TRN  10010101100011000
NAM  STMN4_RAT/48-187
ASQ  SDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEA
DSQ  TCTGATATGGAAGTCATCGAGCTGAATAAGTGTACCTCGGGCCAGTCCTTTGAAGTCATCCTGAAGCCACCTTCCTTTGACGGGGTGCCTGAGTTTAATGCCTCCCTCCCAAGACGTCGAGACCCATCGCTAGAAGAGATACAGAAGAAGCTAGAAGCAGCAGAGGAGCGAAGGAAGTACCAGGAAGCTGAGCTCCTAAAACACCTTGCAGAGAAACGAGAGCATGAGCGTGAGGTAATCCAGAAAGCTATCGAGGAAAACAACAACTTCATCAAGATGGCGAAAGAGAAGCTGGCCCAGAAGATGGAGTCCAATAAGGAAAACCGGGAGGCCCATCTGGCTGCCATGTTGGAGCGGCTGCAAGAGAAGGACAAGCACGCAGAGGAGGTGCGGAAAAACAAGGAGCTGAAGGAAGAGGCC
TRN  10010101100011011
//