EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00739 - X)
FAM  PF00739
PID  X
DES  Trans-activation protein X
IPR  IPR000236
ANO  5
ALN  145
AID  0.607643
APH  (((X_HPBGS/1-138:0.17388,X_WHV1/1-138:0.17740):0.60197,Q80JC8_HPBV0/1-142:0.06302):0.06657,Q80IS4_HPBV0/1-142:0.02681,Q806D2_HPBV0/1-142:0.12734);
ATP  (((X_HPBGS/1-138,X_WHV1/1-138),Q80JC8_HPBV0/1-142),Q80IS4_HPBV0/1-142,Q806D2_HPBV0/1-142);
ATL  1.23699
DNO  4
DLN  435
DID  0.774949
DPH  ((X_HPBGS/1-138:0.47711,Q80JC8_HPBV0/1-142:0.01398):0.04862,Q80IS4_HPBV0/1-142:0.01858,Q806D2_HPBV0/1-142:0.04731);
DTP  ((X_HPBGS/1-138,Q80JC8_HPBV0/1-142),Q80IS4_HPBV0/1-142,Q806D2_HPBV0/1-142);
DTL  0.6056
RID  0.653264
RPH  ((X_HPBGS/1-138:0.75322,Q80JC8_HPBV0/1-142:0.03703):0.09221,Q80IS4_HPBV0/1-142:0.02643,Q806D2_HPBV0/1-142:0.12716);
RTP  ((X_HPBGS/1-138,Q80JC8_HPBV0/1-142),Q80IS4_HPBV0/1-142,Q806D2_HPBV0/1-142);
RTL  1.03605
LNK  Q806D2_HPBV0/1-142:Q806D2:AB100695
LNK  Q80IS4_HPBV0/1-142:Q80IS4:AB104891
LNK  Q80JC8_HPBV0/1-142:Q80JC8:AY251133
LNK  X_HPBGS/1-138:P03168:K02715
LNK  X_WHV1/1-138:P03167:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q80JC8_HPBV0/1-142
ASQ  MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSA--RRMETTVNAHQVLPKVLHKRTLGLSAMSTTDL-EAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLV
DSQ  ATGGCTGCTCGGGTGTGCTGCCAACTGGATCCTGCGCGGGACGTCCTTTGTCTACGTCCCGTCGGCGCTGAATCCCGCGGACGACCCGTCTCGGGGCCGTTTGGGACTCTACCGTCCCCTTCTTCATCTGCCGTTCCGGCCGACCACGGGGCGTACCTCTCTTTACGCGGTCTCCCCGTCTGTGCCTTCTCATCTGCCGGACCGTGTGCACTTCGCTTCACCTCTGCA------CGTCGCATGGAGACCACCGTGAACGCCCACCAGGTCTTGCCCAAGGTCTTACATAAGAGGACTCTTGGACTCTCAGCAATGTCAACGACCGACCTT---GAGGCGTACTTCAAAGACTGTTTGTTTAAGGACTGGGAGGAGTTGGGGGAGGAGATTAGGTTAAAGGTCTTTGTACTAGGAGGCTGTAGGCATAAATTGGTC
TRN  10010101100011000
NAM  Q80IS4_HPBV0/1-142
ASQ  MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSA--RRMETTVNDHRNLSKVLHKRTLGLSAMSTTDL-EAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLV
DSQ  ATGGCTGCTAGGGTGTGCTGCCAACTGGATCCTGCGCGGGACGTCCTTTGTTTACGTCCCGTCGGCGCTGAATCCCGCGGACGACCCCTCCCGGGGCCGCTTGGGGCTCTACCGCCCGCTTCTCCGTCTGCCGTACCGACCGACCACGGGGCGCACCTCTCTTTACGCGGTCTCCCCGTCTGTGCCTTCTCACCTGCCGGACCGTGTGCACTTCGCTTCACCTCTGCA------CGTCGCATGGAAACCACCGTGAACGACCACCGGAACCTGTCCAAGGTCTTGCATAAGAGGACTCTTGGACTTTCAGCAATGTCAACGACCGACCTT---GAGGCATACTTCAAAGACTGTGTGTTTACTGAGTGGGAGGAGCTGGGGGAGGAGATGAGGTTAATGATCTTTGTATTAGGAGGCTGTAGGCATAAATTGGTC
TRN  10010101100011000
NAM  Q806D2_HPBV0/1-142
ASQ  MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSA--RRMETTVNAHRILSKDLRTMTLELSGLSTSDL-EAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLL
DSQ  ATGGCTGCTAGGCTGTGCTGCCAACTGGATCCTGCGCGGGACGTCCTTTGTTTACGTCCCGTCGGCGCTGAATCCCGCGGACGACCCCTCCCGGGGCCGCTTGGGGCTCTACCGCCCGCTCCTCCGTCTGCCGTATCGACCGACCACGGGGCGCACCTCTCTTTACGCGGACTCCCCGTCTGTGCCTTCTCATGTGCCGGACCGTGTGCACTTCGCTTCACCTCTGCA------CGTCGCATGGAGACCACCGTGAACGCCCACCGGATCCTGTCCAAGGACTTACGTACTATGACTCTTGAACTTTCAGGACTGTCGACGTCCGACCTT---GAGGCATACTTCAAAGACCGTGTGTTTACTGAGTGGGAGGAGTTGGGGGAGGAGATTAGGTTAATGATCTTTGTACTAGGAGGCTGTACGCATACATTGCTC
TRN  10010101100011000
NAM  X_WHV1/1-138
ASQ  MAARLCCQLDPARDVLLLRPFGSQSSGPPFPRPSAGSAASPASSLSASDESDLPLGRLPACFASASGPCCLVVTCAELRTMDSTVN----FVSWHANRQLG---MPSKDLWTPYIRDQLLTKWEEGSIDPRLSIFVLGGCRHKCM
NAM  X_HPBGS/1-138
ASQ  MAARLCCQLDSSRDVLLLRPLRGQPSGPSVSGTSAGSPSSAASAFSSGHQADIPVGRLPACFYSSAGPCCLGFTCADLRTMDSTVN----FVPWHAKRQLG---MMQKDFWTAYIRDQLLTLWEEGIIDPRLKLFVLGGCRHKYM
DSQ  ATGGCTGCTCGCCTGTGTTGCCAACTGGATTCTTCGCGGGACGTCCTTCTGTTACGTCCCCTCCGCGGACAACCCAGCGGACCTTCCGTCTCGGGGACTTCTGCCGGCTCTCCGTCCTCTGCCGCTTCTGCGTTTTCGTCCGGTCACCAAGCGGATATCCCTGTGGGCCGCCTCCCCGCCTGTTTCTACTCGTCGGCCGGTCCGTGTTGCTTGGGCTTCACCTGTGCAGACTTGCGAACCATGGATTCCACCGTGAAC------------TTTGTACCCTGGCATGCTAAGCGACAGCTGGGC---------ATGATGCAAAAGGACTTTTGGACTGCTTATATAAGAGATCAATTATTAACTTTATGGGAGGAGGGTATCATCGATCCTAGGCTGAAATTATTTGTATTAGGAGGCTGTAGGCATAAATACATG
TRN  10010101100011010
//