EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00708 - Acylphosphatase)
FAM  PF00708
PID  Acylphosphatase
DES  Acylphosphatase
IPR  IPR001792
ANO  5
ALN  89
AID  0.424098
APH  (ACYP_DROME/4-92:0.59573,((ACYO_HUMAN/5-93:0.29228,ACYO_CHICK/5-93:0.22453):0.07877,ACYM_BOVIN/5-93:0.26999):0.22124,HYPF_SYNY3/1-88:1.48291);
ATP  (ACYP_DROME/4-92,((ACYO_HUMAN/5-93,ACYO_CHICK/5-93),ACYM_BOVIN/5-93),HYPF_SYNY3/1-88);
ATL  3.16545
DNO  3
DLN  267
DID  0.423576
DPH  (HYPF_SYNY3/1-88:0.94717,ACYP_DROME/4-92:0.29550,ACYO_HUMAN/5-93:0.50734);
DTP  (HYPF_SYNY3/1-88,ACYP_DROME/4-92,ACYO_HUMAN/5-93);
DTL  1.75001
RID  0.319181
RPH  (HYPF_SYNY3/1-88:1.62212,ACYP_DROME/4-92:0.38038,ACYO_HUMAN/5-93:0.66293);
RTP  (HYPF_SYNY3/1-88,ACYP_DROME/4-92,ACYO_HUMAN/5-93);
RTL  2.66543
LNK  ACYM_BOVIN/5-93:P07033:
LNK  ACYO_CHICK/5-93:P07032:
LNK  ACYO_HUMAN/5-93:P07311:X84194
LNK  ACYP_DROME/4-92:P56544:AJ243543
LNK  HYPF_SYNY3/1-88:Q55638:D64000
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  HYPF_SYNY3/1-88
ASQ  MLKTVAIQVQGRVQGVGFRPFVYTLAQEMGLNGWVNNSTQG-ATVVITADEKAIADFTERLTKTLPPPGLIEQLAVEQLPLESFTNFTI
DSQ  ATGTTAAAAACCGTTGCCATACAGGTCCAGGGAAGGGTGCAAGGAGTGGGTTTTCGTCCCTTTGTTTATACCCTTGCCCAGGAAATGGGACTGAATGGTTGGGTGAATAATTCCACTCAAGGA---GCTACCGTTGTCATTACCGCCGACGAAAAGGCGATCGCCGACTTTACGGAGAGATTAACGAAGACATTACCTCCCCCTGGTTTGATTGAACAATTAGCCGTTGAACAGTTACCGCTGGAAAGTTTTACTAACTTTACTATC
TRN  10010101100011010
NAM  ACYP_DROME/4-92
ASQ  NVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVEFSSQRERDRYGYAN
DSQ  AATGTCCATTCCTGCGAATTCGAGGTATTTGGCCGCGTGCAGGGCGTCAACTTCCGGCGACACGCCCTGCGAAAGGCCAAGACACTGGGTCTTCGCGGCTGGTGCATGAACTCCAGCAGGGGCACCGTGAAGGGTTACATCGAAGGTCGTCCGGCCGAGATGGATGTGATGAAGGAGTGGCTCAGGACGACGGGCAGTCCGCTGTCCAGCATCGAGAAGGTGGAGTTCAGTTCTCAGCGTGAGCGCGATCGCTATGGCTATGCCAAC
TRN  10010101100011011
NAM  ACYO_HUMAN/5-93
ASQ  TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSD
DSQ  ACCCTGATATCAGTGGATTATGAAATTTTTGGGAAGGTGCAAGGGGTGTTTTTCCGTAAGCATACTCAGGCTGAGGGTAAAAAGCTGGGATTGGTAGGCTGGGTCCAGAACACTGACCGGGGCACAGTGCAAGGACAATTGCAAGGTCCAATCTCCAAGGTGCGTCATATGCAGGAATGGCTTGAAACAAGAGGAAGTCCTAAATCACACATCGACAAAGCAAACTTCAACAATGAAAAAGTCATCTTGAAGTTGGATTACTCAGAC
TRN  10010101100011001
NAM  ACYO_CHICK/5-93
ASQ  GLMSVDYEVSGRVQGVFFRKYTQSEAKRLGLVGWVRNTSHGTVQGQAQGPAARVRELQEWLRKIGSPQSRISRAEFTNEKEIAALEHTD
NAM  ACYM_BOVIN/5-93
ASQ  PLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSS
//