EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00522 - VPR)
FAM  PF00522
PID  VPR
DES  VPR/VPX protein
IPR  IPR000012
ANO  12
ALN  100
AID  0.406084
APH  (VPX_SIVM1/5-99:0.07573,(VPX_HV2NZ/5-99:0.17161,VPX_HV2BE/5-99:0.10063):0.07958,(((VPR_SIVGB/6-84:0.54936,((VPR_HV2D2/6-88:0.12741,((VPR_HV2CA/6-88:0.09547,VPR_HV2D1/6-88:0.17991):0.13275,VPR_SIVM1/2-84:0.06551):0.06557):0.24292,VPR_HV1A2/1-83:0.33793):0.33625):0.36649,(VPX_SIVA1/8-106:0.08393,VPX_SIVAI/8-106:0.34941):0.41427):0.76812,VPX_HV2D2/4-98:0.16212):0.03774);
ATP  (VPX_SIVM1/5-99,(VPX_HV2NZ/5-99,VPX_HV2BE/5-99),(((VPR_SIVGB/6-84,((VPR_HV2D2/6-88,((VPR_HV2CA/6-88,VPR_HV2D1/6-88),VPR_SIVM1/2-84)),VPR_HV1A2/1-83)),(VPX_SIVA1/8-106,VPX_SIVAI/8-106)),VPX_HV2D2/4-98));
ATL  4.74271
DNO  10
DLN  300
DID  0.495172
DPH  (((VPX_SIVA1/8-106:0.17103,VPX_SIVAI/8-106:0.25917):0.17789,((VPX_HV2NZ/5-99:0.13130,VPX_HV2BE/5-99:0.11026):0.07719,VPX_SIVM1/5-99:0.11386):0.56184):0.16698,(VPR_HV1A2/1-83:0.33984,((VPR_HV2CA/6-88:0.07980,VPR_HV2D1/6-88:0.12687):0.13354,VPR_SIVM1/2-84:0.09208):0.19701):0.29374,VPR_SIVGB/6-84:0.42715);
DTP  (((VPX_SIVA1/8-106,VPX_SIVAI/8-106),((VPX_HV2NZ/5-99,VPX_HV2BE/5-99),VPX_SIVM1/5-99)),(VPR_HV1A2/1-83,((VPR_HV2CA/6-88,VPR_HV2D1/6-88),VPR_SIVM1/2-84)),VPR_SIVGB/6-84);
DTL  3.45955
RID  0.39681
RPH  (VPX_SIVM1/5-99:0.12799,(((VPR_SIVGB/6-84:0.50170,(VPR_HV1A2/1-83:0.35307,((VPR_HV2CA/6-88:0.09575,VPR_HV2D1/6-88:0.18048):0.16285,VPR_SIVM1/2-84:0.02871):0.27363):0.36891):0.35591,(VPX_SIVA1/8-106:0.12400,VPX_SIVAI/8-106:0.31164):0.45094):0.88401,VPX_HV2BE/5-99:0.00000):0.12351,VPX_HV2NZ/5-99:0.16059);
RTP  (VPX_SIVM1/5-99,(((VPR_SIVGB/6-84,(VPR_HV1A2/1-83,((VPR_HV2CA/6-88,VPR_HV2D1/6-88),VPR_SIVM1/2-84))),(VPX_SIVA1/8-106,VPX_SIVAI/8-106)),VPX_HV2BE/5-99),VPX_HV2NZ/5-99);
RTL  4.50369
LNK  VPR_HV1A2/1-83:P05952:K02007
LNK  VPR_HV2CA/6-88:P24111:D00835
LNK  VPR_HV2D1/6-88:P17761:J04542
LNK  VPR_HV2D2/6-88:P15837:
LNK  VPR_SIVGB/6-84:P22385:M27470
LNK  VPR_SIVM1/2-84:P05958:Y00277
LNK  VPX_HV2BE/5-99:P18099:M30502
LNK  VPX_HV2D2/4-98:P15836:
LNK  VPX_HV2NZ/5-99:P05915:J03654
LNK  VPX_SIVA1/8-106:P27976:M29975
LNK  VPX_SIVAI/8-106:Q02842:M66437
LNK  VPX_SIVM1/5-99:P05917:Y00277
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VPX_SIVM1/5-99
ASQ  RERIPPGNSGEETIGEAF-EWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQGMSQSYTKYRYLCLIQKALFMHCKKGCRCLG----EGHGAGGW
DSQ  AGGGAGAGAATCCCACCTGGAAACAGTGGAGAAGAGACAATAGGAGAAGCCTTC---GAGTGGCTAAACAGAACAGTAGAGGAGATAAACAGAGAGGCGGTAAACCACCTACCGAGGGAGCTAATTTTCCAGGTTTGGCAAAGGTCTTGGGAATACTGGCATGATGAACAAGGGATGTCACAAAGCTATACAAAATACAGATACTTGTGTTTAATACAAAAGGCTTTATTTATGCATTGCAAGAAAGGCTGTAGATGTCTAGGG------------GAAGGACACGGGGCAGGGGGATGG
TRN  10010101110011000
NAM  VPX_HV2BE/5-99
ASQ  RERVPPGNSGEETIGEAF-EWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWG----EDMGREGL
DSQ  AGAGAAAGGGTACCGCCAGGAAACAGTGGAGAAGAGACCATTGGAGAGGCCTTC---GAGTGGCTAGAGAGGACCATAGAAGCCTTAAACAGGGAGGCAGTGAACCATCTGCCCCGAGAGCTCATTTTCCAGGTGTGGCAAAGGTCCTGGAGATATTGGCATGATGAACAAGGGATGTCAGCAAGCTACACAAAGTATAGATATTTGTGCCTAATGCAAAAAGCTATATTTACACATTTCAAGAGAGGGTGCACTTGCTGGGGG------------GAGGACATGGGCCGGGAAGGATTG
TRN  10010101100011000
NAM  VPX_HV2NZ/5-99
ASQ  RETVPPGNSGEETIEEAF-AWLDRTVEAINREAVNHHPRELIFQVWQRSWRYWHDEQGMSTSYTKYRYLCLIQMAMYMHAKRDGTCLG----GGMGQKGG
DSQ  AGGGAAACAGTGCCACCAGGAAACAGCGGCGAGGAGACTATCGAAGAGGCCTTC---GCATGGCTAGACAGGACAGTAGAGGCTATAAACAGAGAGGCAGTGAATCACCACCCACGAGAGCTCATTTTCCAGGTCTGGCAGAGGTCCTGGAGATACTGGCATGATGAACAAGGGATGTCAACAAGCTACACAAAATATAGATATTTGTGCTTAATACAGATGGCAATGTACATGCATGCTAAGAGAGATGGCACTTGCCTGGGG------------GGAGGCATGGGCCAGAAGGGTGGA
TRN  10010101100011000
NAM  VPX_HV2D2/4-98
ASQ  RERVPPGNSDEETVGEAF-AWLERTITELNRVAVNHLPRELIFQVWQRSWAYWREEQGMSISYTKYRYLLLMQKAMFVHYTKGCRCLQ----EGHGPGGW
NAM  VPX_SIVAI/8-106
ASQ  REPLPGWLEIWDLDREPWDEWLQDMLRDLNEEARRHFGMNMLIRVWNYCVEEG-RRHNTPWNEIGYKYYRIVQKSMFVHFRCGCRRRGPFSPYEERRNGQ
DSQ  AGAGAACCTTTACCAGGATGGCTGGAAATCTGGGATCTAGACAGGGAGCCATGGGACGAATGGCTACAAGACATGCTCAGGGATCTAAACGAAGAAGCCAGAAGGCACTTTGGAATGAACATGCTAATCCGAGTATGGAATTACTGTGTAGAGGAGGGA---AGGAGACATAATACCCCATGGAATGAGATAGGCTACAAGTACTATAGAATTGTTCAAAAGTCTATGTTTGTACATTTCAGATGTGGTTGTAGAAGGAGAGGACCTTTTTCCCCTTACGAAGAGAGGAGAAATGGACAA
TRN  10010101100011010
NAM  VPX_SIVA1/8-106
ASQ  REERPGGLEIWDLSREPWDEWLRDMVEEINNEAKLHFGRELLYQVWNYCQEEG-ERQGRPIAERAYKYYRLVQKALFVHFRCGCRRRQPFEPYEERRNGQ
DSQ  AGAGAGGAGAGACCAGGAGGACTAGAAATTTGGGATCTCAGCAGGGAGCCGTGGGACGAATGGCTCAGAGATATGGTAGAAGAAATCAACAACGAAGCCAAACTGCATTTTGGCCGAGAACTCCTATACCAAGTATGGAATTATTGTCAGGAGGAAGGG---GAGAGACAGGGAAGACCCATAGCGGAAAGGGCATATAAGTATTATCGCTTAGTTCAGAAAGCTCTCTTTGTGCATTTCCGGTGTGGATGTCGCAGGAGACAACCCTTTGAGCCATACGAGGAGAGGAGAAATGGACAA
TRN  10010101100011010
NAM  VPR_SIVM1/2-84
ASQ  EERPPEN---EGPQREPWDEWVVEVLKELKEEALKHFDPRLLTALGNHIYNRHGDTLEG-----AGELIRILQRALFIHFRSGCS---------HSRIGQ
DSQ  GAAGAAAGACCTCCAGAAAAT---------GAAGGCCCACAAAGGGAACCATGGGATGAGTGGGTAGTGGAAGTTCTGAAAGAACTGAAAGAAGAAGCTTTAAAGCATTTTGATCCTCGGCTTCTAACCGCACTTGGTAATCATATCTATAATAGACATGGAGACACCCTTGAGGGA---------------GCAGGAGAACTCATTAGAATCCTCCAACGAGCGCTCTTCATACATTTCAGAAGCGGCTGCAGC---------------------------CATTCCAGAATCGGCCAA
TRN  10010101100011010
NAM  VPR_HV2D2/6-88
ASQ  PEIPPEN---ENPQREPWEEWIGEILEEIKQEALKHFDPRLLTALGNFIYSRHGDTLAG-----AGELIKILQRALFLHFRAGCQ---------HSRIGQ
NAM  VPR_HV2D1/6-88
ASQ  TEFPPED---GTPRRELGSTWVIETLKEIKEEALKHFDPCLLIALGNYIYNRHGDTLEG-----ARELIRVLQRALFVHIRAGCD---------RSRKGQ
DSQ  ACAGAGTTTCCCCCAGAAGAT---------GGGACCCCACGGAGAGAGCTAGGGAGTACCTGGGTAATAGAAACTCTGAAGGAAATCAAGGAAGAAGCCTTAAAACATTTTGATCCCTGCTTGCTAATTGCTCTTGGCAACTATATCTATAATAGACATGGAGACACCCTTGAAGGA---------------GCCAGAGAGCTCATTAGAGTCCTACAACGAGCCCTCTTCGTGCACATCAGAGCGGGATGTGAC---------------------------CGCTCAAGAAAGGGCCAA
TRN  10010101100011000
NAM  VPR_HV2CA/6-88
ASQ  TELPPED---GTPPREPGDEWVIEILRDIKEEALKHFDPRLLTALGGHIYARHGDTLER-----ARELIRVLQRALFTHFRAGCN---------HSRIGQ
DSQ  ACAGAGCTCCCTCCAGAGGAT---------GGGACCCCACCGAGGGAGCCAGGGGATGAATGGGTAATAGAAATCCTGAGAGACATAAAAGAAGAAGCCCTAAAGCACTTTGACCCTCGCTTGCTAACTGCTCTTGGCGGACATATCTATGCTAGACATGGAGACACCCTTGAAAGA---------------GCCAGAGAGCTCATTAGGGTCCTGCAACGAGCCCTCTTCACGCACTTCAGGGCAGGATGCAAC---------------------------CACTCAAGAATTGGCCAA
TRN  10010101100011001
NAM  VPR_HV1A2/1-83
ASQ  MEQAPED---QGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQYIYETYGDTWAG-----VEAIIRILQQLLFIHFRIGCQ---------HSRIGI
DSQ  ATGGAACAAGCCCCAGAAGAC---------CAAGGGCCACAGAGGGAGCCATACAATGAATGGACACTAGAGCTTTTAGAGGAGCTTAAGAGAGAAGCTGTTAGACATTTTCCTAGGCCATGGCTCCATAGCTTAGGACAATATATCTATGAAACTTATGGGGATACTTGGGCAGGA---------------GTGGAAGCCATAATAAGAATTCTGCAACAACTGCTGTTTATTCATTTCAGAATTGGGTGTCAA---------------------------CATAGCAGAATAGGCATT
TRN  10010101100011010
NAM  VPR_SIVGB/6-84
ASQ  DEQVSED---QGPPREPYNQWLADTMEEIKEEARKHFPLIILNAVSEYCVQNTGSEEEA-----CEKFITLMNRAIWVHLAQGCD-------------GT
DSQ  GATGAGCAAGTATCAGAAGAT---------CAAGGACCTCCCAGAGAGCCATACAATCAGTGGCTAGCAGATACTATGGAGGAAATAAAGGAAGAAGCAAGAAAGCACTTCCCTCTCATTATCCTAAATGCAGTATCAGAATATTGTGTGCAAAACACAGGGAGTGAGGAAGAGGCC---------------TGTGAGAAATTTATTACCTTAATGAATAGAGCCATTTGGGTCCACCTAGCTCAAGGGTGTGAT---------------------------------------GGAACC
TRN  10010101110011000
//