EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00505 - HMG_box)
FAM  PF00505
PID  HMG_box
DES  HMG (high mobility group) box
IPR  IPR000910
ANO  30
ALN  71
AID  0.290516
APH  (((((((HMGL_TRYBR/118-186:0.74805,NHP1_BABBO/23-93:0.34184):0.15510,(HMGH_IRV6/54-122:0.92756,NHP6A_YEAST/21-89:0.19309):0.22393):0.18201,(((SOX4_HUMAN/59-127:0.26495,SOX9_CHICK/106-174:0.22424):0.09740,(SOX2_CHICK/39-107:0.02899,SRY_GORGO/60-128:0.35773):0.15723):0.40933,(LEF1_MOUSE/297-365:0.75446,((((FPR1_PODAN/169-237:0.32509,MATB_NEUCR/116-184:0.39980):0.21963,MTMC_SCHPO/103-171:0.44543):0.14387,(MATD_NEUCR/147-215:0.75131,SMR2_PODAN/161-229:0.35087):0.46604):0.23200,MAT2_COCHE/131-199:0.78185):0.24885):0.16324):0.42015):0.08372,(((ABF2_YEAST/43-111:0.74347,(((HMGL_SOYBN/44-113:0.20593,HMGL_IPONI/36-105:0.22146):0.07701,HMGL_VICFA/45-114:0.19435):0.02980,HMGL_WHEAT/42-111:0.24342):0.25843):0.18559,(SSRP_HUMAN/547-615:0.31223,(HMG1A_CHITE/5-71:0.13675,SSRP_DROME/555-621:0.41277):0.20164):0.27202):0.17979,(HMG1_RAT/94-162:0.38970,HMGH_STRPU/100-168:0.45078):0.14139):0.00000):0.23605,(HMGB_TETTH/18-86:0.68126,HMG_TETPY/11-79:0.48682):0.11267):0.32424,UBF1_HUMAN/112-180:0.71283):0.56150,TFAM_MOUSE/49-117:0.19499,TFAM_HUMAN/50-118:0.29179);
ATP  (((((((HMGL_TRYBR/118-186,NHP1_BABBO/23-93),(HMGH_IRV6/54-122,NHP6A_YEAST/21-89)),(((SOX4_HUMAN/59-127,SOX9_CHICK/106-174),(SOX2_CHICK/39-107,SRY_GORGO/60-128)),(LEF1_MOUSE/297-365,((((FPR1_PODAN/169-237,MATB_NEUCR/116-184),MTMC_SCHPO/103-171),(MATD_NEUCR/147-215,SMR2_PODAN/161-229)),MAT2_COCHE/131-199)))),(((ABF2_YEAST/43-111,(((HMGL_SOYBN/44-113,HMGL_IPONI/36-105),HMGL_VICFA/45-114),HMGL_WHEAT/42-111)),(SSRP_HUMAN/547-615,(HMG1A_CHITE/5-71,SSRP_DROME/555-621))),(HMG1_RAT/94-162,HMGH_STRPU/100-168))),(HMGB_TETTH/18-86,HMG_TETPY/11-79)),UBF1_HUMAN/112-180),TFAM_MOUSE/49-117,TFAM_HUMAN/50-118);
ATL  18.4596
DNO  26
DLN  213
DID  0.429452
DPH  ((((((((((HMG1_RAT/94-162:0.24928,(HMGL_SOYBN/44-113:0.27633,HMGL_WHEAT/42-111:0.17244):0.18781):0.07902,HMGH_STRPU/100-168:0.34759):0.07108,(HMGB_TETTH/18-86:0.48913,((TFAM_MOUSE/49-117:0.16435,TFAM_HUMAN/50-118:0.14226):0.43615,UBF1_HUMAN/112-180:0.38698):0.13776):0.10212):0.03969,(SSRP_DROME/555-621:0.26586,(HMG1A_CHITE/5-71:0.27167,SSRP_HUMAN/547-615:0.25146):0.12391):0.15411):0.04244,(((HMGH_IRV6/54-122:0.70377,NHP6A_YEAST/21-89:0.15646):0.07421,ABF2_YEAST/43-111:0.68552):0.15298,(HMGL_TRYBR/118-186:0.44688,NHP1_BABBO/23-93:0.25274):0.06227):0.09708):0.13702,(LEF1_MOUSE/297-365:0.56754,((SOX4_HUMAN/59-127:0.22435,SOX9_CHICK/106-174:0.11785):0.03406,(SOX2_CHICK/39-107:0.13353,SRY_GORGO/60-128:0.27410):0.12740):0.34797):0.00841):0.15825,MAT2_COCHE/131-199:0.55478):0.15200,MTMC_SCHPO/103-171:0.46295):0.10839,FPR1_PODAN/169-237:0.28476):0.30880,MATD_NEUCR/147-215:0.46543,SMR2_PODAN/161-229:0.22183);
DTP  ((((((((((HMG1_RAT/94-162,(HMGL_SOYBN/44-113,HMGL_WHEAT/42-111)),HMGH_STRPU/100-168),(HMGB_TETTH/18-86,((TFAM_MOUSE/49-117,TFAM_HUMAN/50-118),UBF1_HUMAN/112-180))),(SSRP_DROME/555-621,(HMG1A_CHITE/5-71,SSRP_HUMAN/547-615))),(((HMGH_IRV6/54-122,NHP6A_YEAST/21-89),ABF2_YEAST/43-111),(HMGL_TRYBR/118-186,NHP1_BABBO/23-93))),(LEF1_MOUSE/297-365,((SOX4_HUMAN/59-127,SOX9_CHICK/106-174),(SOX2_CHICK/39-107,SRY_GORGO/60-128)))),MAT2_COCHE/131-199),MTMC_SCHPO/103-171),FPR1_PODAN/169-237),MATD_NEUCR/147-215,SMR2_PODAN/161-229);
DTL  11.7128
RID  0.283961
RPH  (((((((ABF2_YEAST/43-111:0.97945,(SSRP_HUMAN/547-615:0.32962,(HMG1A_CHITE/5-71:0.16712,SSRP_DROME/555-621:0.38107):0.17993):0.08035):0.25283,(((HMGH_IRV6/54-122:0.92988,NHP6A_YEAST/21-89:0.18640):0.24883,NHP1_BABBO/23-93:0.42124):0.11937,HMGL_TRYBR/118-186:0.73250):0.10725):0.04371,(((((FPR1_PODAN/169-237:0.44267,MTMC_SCHPO/103-171:0.48249):0.09644,(MATD_NEUCR/147-215:0.74480,SMR2_PODAN/161-229:0.35258):0.46740):0.19897,MAT2_COCHE/131-199:0.81509):0.21090,LEF1_MOUSE/297-365:0.80678):0.15258,((SOX4_HUMAN/59-127:0.26747,SOX9_CHICK/106-174:0.22275):0.11560,(SOX2_CHICK/39-107:0.03481,SRY_GORGO/60-128:0.35237):0.13750):0.46292):0.41687):0.10626,((HMG1_RAT/94-162:0.24999,(HMGL_SOYBN/44-113:0.28917,HMGL_WHEAT/42-111:0.17230):0.52785):0.16053,HMGH_STRPU/100-168:0.50165):0.04211):0.35186,HMGB_TETTH/18-86:0.74296):0.22742,UBF1_HUMAN/112-180:0.77038):0.57396,TFAM_MOUSE/49-117:0.11753,TFAM_HUMAN/50-118:0.36929);
RTP  (((((((ABF2_YEAST/43-111,(SSRP_HUMAN/547-615,(HMG1A_CHITE/5-71,SSRP_DROME/555-621))),(((HMGH_IRV6/54-122,NHP6A_YEAST/21-89),NHP1_BABBO/23-93),HMGL_TRYBR/118-186)),(((((FPR1_PODAN/169-237,MTMC_SCHPO/103-171),(MATD_NEUCR/147-215,SMR2_PODAN/161-229)),MAT2_COCHE/131-199),LEF1_MOUSE/297-365),((SOX4_HUMAN/59-127,SOX9_CHICK/106-174),(SOX2_CHICK/39-107,SRY_GORGO/60-128)))),((HMG1_RAT/94-162,(HMGL_SOYBN/44-113,HMGL_WHEAT/42-111)),HMGH_STRPU/100-168)),HMGB_TETTH/18-86),UBF1_HUMAN/112-180),TFAM_MOUSE/49-117,TFAM_HUMAN/50-118);
RTL  17.0261
LNK  ABF2_YEAST/43-111:Q02486:Z48952
LNK  FPR1_PODAN/169-237:P35693:X64195
LNK  HMG1A_CHITE/5-71:P40622:M93253
LNK  HMG1_RAT/94-162:P63159:M64986
LNK  HMGB_TETTH/18-86:P40626:M63425
LNK  HMGH_IRV6/54-122:P40628:L22300
LNK  HMGH_STRPU/100-168:P40644:L06453
LNK  HMGL_IPONI/36-105:P40619:
LNK  HMGL_SOYBN/44-113:P26585:X58245
LNK  HMGL_TRYBR/118-186:P26586:M74017
LNK  HMGL_VICFA/45-114:P40620:
LNK  HMGL_WHEAT/42-111:P40621:Z11540
LNK  HMG_TETPY/11-79:P40625:
LNK  LEF1_MOUSE/297-365:P27782:X58636
LNK  MAT2_COCHE/131-199:Q02991:X68398
LNK  MATB_NEUCR/116-184:P36981:
LNK  MATD_NEUCR/147-215:Q10116:AABX01000036
LNK  MTMC_SCHPO/103-171:P10840:X07642
LNK  NHP1_BABBO/23-93:P40632:M81360
LNK  NHP6A_YEAST/21-89:P11632:X15317
LNK  SMR2_PODAN/161-229:Q08143:X73830
LNK  SOX2_CHICK/39-107:P48430:U12532
LNK  SOX4_HUMAN/59-127:Q06945:X70683
LNK  SOX9_CHICK/106-174:P48434:U12533
LNK  SRY_GORGO/60-128:P48046:X86382
LNK  SSRP_DROME/555-621:Q05344:X68408
LNK  SSRP_HUMAN/547-615:Q08945:M86737
LNK  TFAM_HUMAN/50-118:Q00059:M62810
LNK  TFAM_MOUSE/49-117:P40630:U57939
LNK  UBF1_HUMAN/112-180:P17480:X53390
AMK  xxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  UBF1_HUMAN/112-180
ASQ  PKKPLTPYFRFFMEKRAKYAKLHP..EMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
DSQ  CCAAAGAAGCCCCTGACCCCTTATTTCCGCTTCTTCATGGAGAAGCGGGCCAAGTATGCGAAACTCCACCCT......GAGATGAGCAACCTGGACCTAACCAAGATTCTGTCCAAGAAATACAAGGAGCTTCCGGAGAAGAAGAAGATGAAATATATTCAGGACTTCCAGAGAGAGAAACAGGAGTTCGAGCGAAACCTGGCCCGATTCAGG
TRN  10010101100011011
NAM  TFAM_HUMAN/50-118
ASQ  PKKPVSSYLRFSKEQLPIFKAQNP..DAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK
DSQ  CCAAAGAAACCTGTAAGTTCTTACCTTCGATTTTCTAAAGAACAACTACCCATATTTAAAGCTCAGAACCCA......GATGCAAAAACTACAGAACTAATTAGAAGAATTGCCCAGCGTTGGAGGGAACTTCCTGATTCAAAGAAAAAAATATATCAAGATGCTTATAGGGCGGAGTGGCAGGTATATAAAGAAGAGATAAGCAGATTTAAA
TRN  10010101110011001
NAM  TFAM_MOUSE/49-117
ASQ  PKKPMSSYLRFSTEQLPKFKAKHP..DAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYK
DSQ  CCAAAGAAACCTATGAGTTCATACCTTCGATTTTCCACAGAACAGCTACCCAAATTTAAAGCTAAACACCCA......GATGCAAAACTTTCAGAATTGGTTAGGAAAATTGCAGCCCTGTGGAGGGAGCTACCAGAAGCAGAAAAAAAGGTTTATGAAGCTGATTTTAAAGCTGAGTGGAAAGCATACAAAGAAGCTGTGAGCAAGTATAAA
TRN  10010101100011001
NAM  SSRP_HUMAN/547-615
ASQ  PKRPMSAYMLWLNASREKIKSDHP..GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYE
DSQ  CCCAAGAGGCCCATGTCTGCATACATGCTGTGGCTCAATGCCAGCCGAGAGAAGATCAAGTCAGACCATCCT......GGCATCAGCATCACGGATCTTTCCAAGAAGGCAGGCGAGATCTGGAAGGGAATGTCCAAAGAGAAGAAAGAGGAGTGGGATCGCAAGGCTGAGGATGCCAGGAGGGACTATGAAAAAGCCATGAAAGAATATGAA
TRN  10010101100011001
NAM  HMG1A_CHITE/5-71
ASQ  PKRPLSAYMLWLNSARESIKKENP..DFKVTEIAKKGGELWRGMKD--KSEWEAKAAKMKEEYEKAMKEFE
DSQ  CCAAAGCGTCCTCTTTCCGCATACATGTTATGGCTTAACTCAGCTAGAGAGTCGATCAAGAAAGAAAATCCA......GACTTCAAAGTAACGGAAATCGCAAAGAAGGGTGGCGAATTATGGCGTGGAATGAAAGAT------AAGAGCGAATGGGAGGCTAAAGCCGCCAAAATGAAGGAAGAATATGAGAAGGCAATGAAAGAATTTGAA
TRN  10010101110011000
NAM  SSRP_DROME/555-621
ASQ  PKRATTAFMLWLNDTRESIKRENP..GIKVTEIAKKGGEMWKELKD--KSKWEDAAAKDKQRYHDEMRNYK
DSQ  CCCAAGCGCGCCACCACCGCTTTCATGCTCTGGCTGAACGACACGCGCGAGAGCATCAAGAGGGAAAATCCG......GGCATAAAGGTTACCGAGATCGCCAAGAAGGGCGGCGAGATGTGGAAGGAGCTGAAGGAC------AAGTCCAAGTGGGAGGATGCGGCGGCCAAGGACAAGCAGCGCTACCACGACGAGATGCGCAACTACAAG
TRN  10010101100011011
NAM  ABF2_YEAST/43-111
ASQ  PKRPTSAYFLYLQDHRSQFVKENP..TLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFD
DSQ  CCTAAAAGGCCCACATCTGCTTATTTCTTATATTTGCAAGACCACAGAAGTCAATTCGTTAAGGAAAATCCA......ACCTTACGTCCTGCTGAAATCAGCAAGATTGCCGGTGAAAAGTGGCAAAATTTAGAGGCTGATATAAAGGAAAAATACATTTCTGAAAGAAAAAAGTTGTATTCTGAATACCAAAAGGCGAAGAAGGAGTTTGAC
TRN  10010101110011010
NAM  HMGL_WHEAT/42-111
ASQ  PKRAPSAFFVFMGEFREEFKQKNP.kNKSVAAVGKAAGERWKSLSESEKAPYVAKANKLKGEYNKAIAAYN
DSQ  CCCAAGAGGGCGCCATCCGCCTTCTTCGTCTTCATGGGCGAGTTCCGCGAGGAGTTCAAGCAGAAGAACCCC...aagAACAAGTCCGTCGCCGCCGTCGGCAAAGCGGCCGGTGAGAGGTGGAAGAGCTTGAGCGAATCGGAAAAGGCCCCCTATGTGGCCAAGGCCAACAAGCTCAAGGGCGAGTACAACAAGGCCATTGCTGCCTACAAC
TRN  10010101110011011
NAM  HMGL_VICFA/45-114
ASQ  PKRPPSAFFVFMADFREQYKKDHP.nNKSVAAVGKACGEEWKSLSEEEKAPYVDRALKKKEEYEITLQAYN
NAM  HMGL_IPONI/36-105
ASQ  PKRPPSAFFVFMEDFRKTYKEKHP.nNKSVAVVGKAGGDKWKQLTAAEKAPFISKAEKRKQEYEKNLQAYN
NAM  HMGL_SOYBN/44-113
ASQ  PKRPPSAFFVFMEEFRKVFNKEHP.eNKAVSAVGKAAGAKWKTMSDAEKAPYVAKSEKRKVEYEKNMRAYN
DSQ  CCAAAGAGGCCTCCAAGTGCTTTCTTCGTTTTCATGGAGGAGTTCAGGAAGGTATTCAACAAAGAACATCCT...gaaAACAAAGCAGTGTCTGCTGTGGGCAAAGCTGCTGGAGCAAAATGGAAGACCATGTCTGATGCTGAAAAAGCACCTTATGTGGCAAAGTCTGAGAAAAGGAAAGTGGAGTACGAGAAGAACATGAGAGCCTATAAC
TRN  10110101110011011
NAM  HMGH_STRPU/100-168
ASQ  PKRNLSAFFIFSGENRAAIKSVHP..NWSVGDIAKELAVRWRAMTAGEKIPFDKGAAKDKERYIKAMAEYK
DSQ  CCCAAGAGGAATCTGTCAGCATTCTTCATCTTCAGTGGAGAGAACAGAGCAGCCATAAAGAGTGTTCATCCC......AACTGGTCTGTGGGTGATATCGCCAAAGAACTGGCCGTCAGGTGGAGAGCTATGACTGCTGGGGAAAAGATTCCGTTTGACAAAGGTGCTGCTAAGGACAAGGAGAGATACATCAAGGCCATGGCCGAGTACAAG
TRN  10010101100011001
NAM  HMG1_RAT/94-162
ASQ  PKRPPSAFFLFCSEYRPKIKGEHP..GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYR
DSQ  CCCAAGAGGCCTCCTTCGGCCTTCTTCTTGTTCTGTTCTGAGTACCGCCCAAAAATCAAAGGCGAGCATCCT......GGCTTATCCATTGGTGATGTTGCGAAGAAACTAGGAGAGATGTGGAACAACACTGCTGCGGATGACAAGCAGCCCTATGAAAAGAAGGCCGCCAAGCTGAAGGAGAAGTATGAGAAGGATATTGCTGCCTACAGA
TRN  10010101100011010
NAM  NHP6A_YEAST/21-89
ASQ  PKRALSAYMFFANENRDIVRSENP..DITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYN
DSQ  CCTAAGAGGGCTTTGTCCGCCTACATGTTTTTCGCTAACGAAAACAGAGATATTGTTCGTTCTGAAAATCCA......GATATCACATTTGGACAAGTCGGCAAGAAGTTGGGTGAGAAGTGGAAGGCTCTAACGCCAGAGGAAAAGCAGCCTTACGAGGCCAAGGCCCAGGCCGATAAGAAGAGATATGAATCCGAAAAGGAGTTATATAAC
TRN  10010101110011010
NAM  NHP1_BABBO/23-93
ASQ  PKRALSSYMFFAKEKRVEIIAENPeiAKDVAAIGKMIGAAWNALSDEEKKPYERMSDEDRVRYEREKAEYA
DSQ  CCTAAGCGTGCTTTATCTTCTTACATGTTTTTTGCTAAGGAGAAGCGTGTAGAGATAATTGCTGAGAACCCTgagatcGCTAAGGACGTTGCTGCTATCGGTAAGATGATCGGTGCTGCTTGGAATGCTCTTTCTGATGAGGAGAAGAAGCCCTATGAGCGCATGTCTGATGAAGATCGTGTTAGGTACGAGCGTGAGAAGGCTGAGTACGCC
TRN  10010101110011010
NAM  HMGH_IRV6/54-122
ASQ  PKRNKSSYLFFCQEIRPSIVAEMP..DIKPNQVMVHLGKKWSELPLEDRKKYDVMAVEDRKRYLASKEANK
DSQ  CCTAAAAGAAATAAATCAAGTTATCTTTTTTTCTGTCAAGAAATTAGACCCAGTATAGTTGCAGAAATGCCA......GATATTAAACCAAATCAAGTTATGGTACATTTAGGTAAAAAATGGTCTGAATTGCCATTAGAAGATAGAAAAAAATATGATGTAATGGCTGTAGAAGATCGTAAACGTTATTTAGCATCTAAAGAGGCTAACAAA
TRN  10010101110011000
NAM  HMG_TETPY/11-79
ASQ  PKRPLSAFFLFKQHNYDQVKKENP..NAKITELTSMIAEKWKHVTEKEKKKYEGLQQEAKAKYEKDMQAYE
NAM  HMGB_TETTH/18-86
ASQ  PKRPQTGFFIYKSEVFAKRRTECP..TLKVPEIVSKISEEYKALPEKEKQKYEEAYRKEKATYDKQNDQWK
DSQ  CCCAAGAGACCCCAAACCGGTTTCTTCATCTACAAGAGTGAAGTCTTTGCCAAGAGAAGAACTGAGTGCCCC......ACCTTGAAGGTCCCTGAAATCGTCTCTAAAATTAGTGAAGAATACAAGGCCTTACCTGAAAAGGAGAAGTAAAAATACGAAGAAGCCTACAGAAAGGAAAAGGCCACCTACGATAAGTAAAACGACCAATGGAAA
TRN  00000100000000000
NAM  HMGL_TRYBR/118-186
ASQ  PKPAVSSYLLFVADQREELKAKNP..GMQNTAILQTLGKMWSDASDDVKEHYRKKAEEDKARFRREVDEYK
DSQ  CCTAAGCCGGCTGTCAGTTCTTATTTACTTTTCGTAGCTGATCAGCGCGAGGAGCTGAAGGCGAAAAACCCC......GGGATGCAGAATACTGCGATTCTTCAGACGTTGGGTAAAATGTGGAGTGATGCGTCCGATGACGTGAAAGAGCATTACAGAAAGAAGGCAGAGGAGGACAAGGCCCGATTCCGGCGTGAAGTAGACGAGTACAAG
TRN  10010101100011010
NAM  SRY_GORGO/60-128
ASQ  VKRPMNAFIVWSRDQRRKMALENP..RMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYK
DSQ  GTGAAGCGACCCATGAACGCATTCATCGTGTGGTCTCGCGATCAGAGGCGCAAGATGGCTCTAGAGAATCCC......AGAATGCGAAACTCAGAGATCAGCAAGCAGCTGGGATACCAGTGGAAAATGCTTACTGAAGCCGAAAAATGGCCATTCTTCCAGGAGGCACAGAAATTACAGGCCATGCACAGAGAGAAATACCCGAATTATAAG
TRN  10010101100011000
NAM  SOX2_CHICK/39-107
ASQ  VKRPMNAFMVWSRGQRRKMAQENP..KMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYK
DSQ  GTCAAGCGCCCCATGAACGCCTTCATGGTGTGGTCCCGCGGGCAGCGGCGGAAAATGGCCCAGGAGAACCCG......AAGATGCACAACTCGGAGATCAGCAAACGGCTCGGGGCCGAGTGGAAACTTTTATCCGAGGCGGAGAAGAGACCCTTCATTGACGAAGCCAAACGGCTCCGAGCTCTGCACATGAAGGAGCACCCGGATTATAAA
TRN  10010101100011010
NAM  SOX9_CHICK/106-174
ASQ  VKRPMNAFMVWAQAARRKLADQYP..HLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYK
DSQ  GTGAAGCGCCCCATGAACGCCTTCATGGTGTGGGCCCAGGCGGCTCGAAGGAAGCTGGCTGACCAGTACCCG......CATCTGCACAACGCCGAGCTCAGCAAGACGCTGGGCAAGCTGTGGAGGCTGCTGAATGAGAGCGAGAAGCGTCCCTTCGTGGAGGAGGCCGAGCGGCTGCGGGTGCAGCACAAGAAGGACCACCCCGACTACAAG
TRN  10010101100011011
NAM  SOX4_HUMAN/59-127
ASQ  IKRPMNAFMVWSQIERRKIMEQSP..DMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYK
DSQ  ATCAAGCGACCCATGAACGCCTTCATGGTGTGGTCGCAGATCGAGCGGCGCAAGATCATGGAGCAGTCGCCC......GACATGCACAACGCCGAGATCTCCAAGCGGCTGGGCAAACGCTGGAAGCTGCTCAAAGACAGCGACAAGATCCCTTTCATTCGAGAGGCGGAGCGGCTGCGCCTCAAGCACATGGCTGACTACCCCGACTACAAG
TRN  11011101101011011
NAM  MAT2_COCHE/131-199
ASQ  APRPMNCWIIFRDAMHKHLKAEFP..HLTIQEISTRCSHIWHNLSPEAKKPWQDAAQSAKEEHLRQHPNYK
DSQ  GCTCCCCGCCCGATGAACTGTTGGATTATTTTCCGAGATGCAATGCACAAGCATCTAAAGGCCGAATTCCCA......CACCTCACTATTCAAGAGATCTCTACGCGTTGCTCTCACATTTGGCACAACCTCTCTCCTGAAGCCAAAAAGCCCTGGCAGGACGCTGCCCAATCTGCAAAAGAAGAACACCTCCGCCAGCACCCCAATTACAAG
TRN  11011101111011011
NAM  LEF1_MOUSE/297-365
ASQ  IKKPLNAFMLYMKEMRANVVAECT..LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWS
DSQ  ATTAAGAAGCCTCTGAATGCTTTCATGTTATATATGAAAGAAATGAGAGCGAATGTCGTAGCTGAGTGCACG......CTAAAGGAGAGTGCAGCTATCAACCAGATCCTGGGCAGAAGATGGCACGCCCTCTCCCGGGAAGAGCAGGCCAAATACTATGAACTAGCACGGAAAGAGAGACAGCTACACATGCAGCTTTATCCAGGCTGGTCA
TRN  10010101100011000
NAM  SMR2_PODAN/161-229
ASQ  IRRPRNQFIIYRQWMSARLHEDNP..GLTAGAISSIVAKAWKGETPQVKAHFKALAVEEDRKHKLAYPGYR
DSQ  ATTCGTCGCCCCCGCAACCAGTTCATCATCTACCGCCAGTGGATGTCTGCTCGGCTCCACGAGGACAACCCC......GGCTTGACAGCTGGTGCTATTTCGTCCATCGTCGCTAAGGCTTGGAAGGGGGAGACACCCCAGGTCAAAGCTCACTTCAAGGCTCTCGCGGTGGAGGAAGACCGCAAGCACAAACTGGCGTATCCTGGGTACCGG
TRN  11011101101011011
NAM  MATD_NEUCR/147-215
ASQ  TSRPRNQFVLYYQWLLDTLFSEDP..SLSARNISQIVAGLWNSEHPAAKARFRELAEMEVHRHRAENPHLY
DSQ  ACTAGCCGCCCGCGCAACCAATTCGTTCTCTACTACCAATGGCTGTTGGATACTCTGTTCTCCGAAGATCCG......AGTCTTTCAGCTCGCAATATTTCTCAAATTGTTGCGGGCTTGTGGAACAGCGAGCACCCCGCGGCAAAAGCTCGCTTCAGGGAACTGGCGGAAATGGAGGTTCATCGTCATCGAGCTGAGAATCCTCACCTTTAC
TRN  10010101100011001
NAM  MTMC_SCHPO/103-171
ASQ  TPRPPNAFILYRKEKHATLLKSNP..SINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPGYK
DSQ  ACTCCGAGACCCCCTAATGCTTTTATATTATACAGGAAGGAAAAACATGCTACATTATTAAAGTCTAACCCT......TCCATCAATAATTCACAAGTTTCCAAGCTGGTTGGAGAGATGTGGAGAAACGAATCAAAGGAAGTACGTATGCGATATTTTAAGATGTCTGAGTTTTATAAAGCACAACATCAGAAAATGTACCCTGGTTATAAG
TRN  10010101100011000
NAM  MATB_NEUCR/116-184
ASQ  IPRPPNAYILYRKDHHREIREQNP..GLHNNEISVIVGNMWRDEQPHIREKYFNMSNEIKTRLLLENPDYR
NAM  FPR1_PODAN/169-237
ASQ  IPRPPNAYILYRKDQQAALKAANP..GIPNNDISVMTGGMWKKESPEVRAEYQRRASEIKAKLMSAHPHYR
DSQ  ATTCCCCGCCCCCCTAACGCCTACATTCTTTACCGCAAGGATCAGCAGGCTGCGCTTAAGGCGGCTAACCCT......GGCATCCCCAACAATGACATTTCCGTCATGACTGGTGGCATGTGGAAGAAAGAGTCCCCCGAAGTTCGCGCCGAGTACCAGAGACGTGCGAGTGAGATCAAGGCGAAACTGATGTCGGCTCACCCTCATTATCGC
TRN  10010101100011011
//