EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00440 - TetR_N)
FAM  PF00440
PID  TetR_N
DES  Bacterial regulatory proteins, tetR family
IPR  IPR001647
ANO  112
ALN  49
AID  0.305189
APH  (((((((((((((P96856_MYCTU/21-67:0.36372,Y790_MYCBO/35-81:0.61235):0.09166,((Q54288_STRHY/25-71:0.44413,(O50423_MYCTU/23-69:0.37233,P72185_9ACTO/45-91:0.21283):0.05637):0.14069,((O53317_MYCTU/26-72:0.33683,Q51730_PSEFL/22-68:0.56780):0.13572,Y1581_MYCBO/25-71:0.47211):0.09593):0.39475):0.11772,((Q9ZFC1_MYCSM/18-64:0.61332,O54102_STRCO/20-66:0.34362):0.08032,O69909_STRCO/12-58:0.60046):0.08813):0.13343,(((Y1388_MYCBO/21-67:0.67887,(Q9Z480_9RHIZ/8-54:0.09943,(((TER5_ECOLI/9-55:0.43744,TER4_ECOLI/8-54:0.00000):0.21259,TER3_ECOLI/9-55:0.12201):0.13172,Q9Z551_STRCO/18-64:0.67272):0.05623):0.20128):0.00000,(Q53901_STRCO/36-82:0.26266,O52558_AMYMD/34-80:0.45903):0.40177):0.22201,O87854_STRCO/12-58:0.52141):0.14899):0.07829,(YIJC_ECOLI/15-62:0.54103,O53295_MYCTU/35-80:0.94247):0.20081):0.13927,((PKSA_BACSU/14-57:0.56821,(Q53772_STAAU/14-60:0.56252,YDH1_XANAU/20-66:0.62511):0.15208):0.07165,((BETI_ECOLI/14-60:0.50550,BETI_RHIME/14-60:0.49352):0.07950,(O33453_PSEPU/19-65:0.73572,(O86510_STRCO/15-61:0.49038,Q55363_SYNY3/17-63:0.63833):0.05289):0.18428):0.12621):0.20809):0.19557,(((((O66658_AQUAE/15-61:0.33033,((YCFQ_ECOLI/24-70:0.33470,YJGJ_ECOLI/21-67:0.69560):0.53948,O32228_BACSU/5-50:0.57241):0.10836):0.18887,(Q9ZGB7_STRCY/16-62:0.50156,(Q51516_PSEAE/7-53:0.15001,Q9Z3X8_9PSED/7-53:0.08429):0.56061):0.00000):0.09088,(((YUXN_BACSU/8-54:0.07080,YERO_BACSU/8-54:0.34359):0.20419,P94423_BACSU/8-54:0.47706):0.11476,O28458_ARCFU/8-54:0.62640):0.08403):0.11168,((Q59306_CLOPA/8-54:0.42245,(((O69500_MYCLE/17-63:0.44826,O27135_METTH/17-63:0.47044):0.13186,O05858_MYCTU/44-90:0.55632):0.09766,(((O86852_STRCO/14-60:0.12475,((AFRP_STRGR/14-60:0.25277,(O24739_STRVG/15-61:0.56928,O66121_STRCO/14-60:0.19833):0.18015):0.05363,Q9ZHP8_STRFR/13-59:0.23534):0.15618):0.20872,(((YXAF_BACSU/11-58:0.20951,O34619_BACSU/10-57:0.04013):0.45357,O85706_CLOAB/14-60:0.38821):0.12623,(((TCMR_STRGA/32-78:0.85157,O53054_LISIV/8-54:0.07593):0.30145,Q59213_BACME/8-54:0.36784):0.20880,YPB3_LACLA/13-59:0.47134):0.13739):0.20698):0.18202,((YWCC_BACSU/17-63:0.83518,P96812_MYCTU/20-66:0.58258):0.14706,(QACR_STAAM/7-53:0.38552,O67157_AQUAE/7-53:0.30725):0.14526):0.07657):0.08557):0.03831):0.02611,(((Y893_HAEIN/12-58:0.62124,P94548_BACSU/11-57:0.32986):0.19620,(YHGD_BACSU/9-55:0.29871,(BM3R_BACME/11-57:0.14630,O08335_BACSU/12-58:0.22147):0.43237):0.18544):0.05726,((((O66635_AQUAE/12-58:0.22820,P96701_BACSU/12-58:0.50675):0.10008,((P95100_MYCTU/26-72:0.53322,P96222_MYCTU/29-75:0.40883):0.43179,Q9ZN97_ECOLI/22-68:0.60225):0.16138):0.09907,(UIDR_ECOLI/16-62:0.45043,O07001_BACSU/12-58:0.35583):0.09908):0.16488,(O31560_BACSU/17-63:0.54818,O08377_MYCTU/24-70:0.42614):0.06815):0.15368):0.08956):0.08509):0.08259,((O27815_METTH/18-64:0.54836,O34643_BACSU/8-54:0.16863):0.20229,(P73186_SYNY3/47-93:0.52751,((O67930_AQUAE/8-54:0.80795,(TTK_HAEIN/36-82:0.27827,TTK_ECOLI/16-62:0.23026):0.54091):0.18205,O67927_AQUAE/18-64:0.15285):0.21458):0.13234):0.17950):0.06482):0.13546,((Q9Z601_NOSPU/12-57:0.41843,((YBIH_ECOLI/17-62:0.47002,(YTTP_BACSU/9-55:0.65026,O07252_MYCTU/11-57:0.51236):0.09443):0.17364,(LUXR_VIBHA/21-67:0.79762,O86312_MYCTU/12-57:0.45136):0.19351):0.15222):0.11548,(O53612_MYCTU/19-64:0.61278,(Y3439_MYCBO/23-69:0.41996,O33187_MYCTU/24-70:0.45189):0.17865):0.03064):0.15883):0.09051,(((O54185_STRCO/76-120:0.55802,O07254_MYCTU/13-59:0.90089):0.21545,((((O07229_MYCTU/19-65:0.54376,O53310_MYCTU/15-61:0.43139):0.00000,P95251_MYCTU/223-269:0.65549):0.21040,(O06169_MYCTU/30-76:0.24546,P95251_MYCTU/19-65:0.42091):0.16324):0.13487,(P96839_MYCTU/15-61:0.52071,((O86514_STRCO/19-65:0.35729,O53323_MYCTU/22-68:0.38880):0.31667,O08306_NOCSI/21-64:0.25670):0.10878):0.14625):0.13727):0.08059,(O53165_MYCTU/16-62:0.63735,(O68442_9RHIZ/15-61:0.50535,((ENVR_ECOLI/16-62:0.44956,ACRR_ECOLI/16-62:0.16966):0.11098,MTRR_NEIGO/15-61:0.32816):0.18910):0.09423):0.00000):0.10063):0.02673,TETC_ECOLI/18-64:0.63844):0.00640,P96821_MYCTU/93-139:0.55442):0.34165,P72624_SYNY3/24-70:0.30464):0.49188,O53623_MYCTU/19-65:0.00000,O53119_MYCLE/19-65:0.33350);
ATP  (((((((((((((P96856_MYCTU/21-67,Y790_MYCBO/35-81),((Q54288_STRHY/25-71,(O50423_MYCTU/23-69,P72185_9ACTO/45-91)),((O53317_MYCTU/26-72,Q51730_PSEFL/22-68),Y1581_MYCBO/25-71))),((Q9ZFC1_MYCSM/18-64,O54102_STRCO/20-66),O69909_STRCO/12-58)),(((Y1388_MYCBO/21-67,(Q9Z480_9RHIZ/8-54,(((TER5_ECOLI/9-55,TER4_ECOLI/8-54),TER3_ECOLI/9-55),Q9Z551_STRCO/18-64))),(Q53901_STRCO/36-82,O52558_AMYMD/34-80)),O87854_STRCO/12-58)),(YIJC_ECOLI/15-62,O53295_MYCTU/35-80)),((PKSA_BACSU/14-57,(Q53772_STAAU/14-60,YDH1_XANAU/20-66)),((BETI_ECOLI/14-60,BETI_RHIME/14-60),(O33453_PSEPU/19-65,(O86510_STRCO/15-61,Q55363_SYNY3/17-63))))),(((((O66658_AQUAE/15-61,((YCFQ_ECOLI/24-70,YJGJ_ECOLI/21-67),O32228_BACSU/5-50)),(Q9ZGB7_STRCY/16-62,(Q51516_PSEAE/7-53,Q9Z3X8_9PSED/7-53))),(((YUXN_BACSU/8-54,YERO_BACSU/8-54),P94423_BACSU/8-54),O28458_ARCFU/8-54)),((Q59306_CLOPA/8-54,(((O69500_MYCLE/17-63,O27135_METTH/17-63),O05858_MYCTU/44-90),(((O86852_STRCO/14-60,((AFRP_STRGR/14-60,(O24739_STRVG/15-61,O66121_STRCO/14-60)),Q9ZHP8_STRFR/13-59)),(((YXAF_BACSU/11-58,O34619_BACSU/10-57),O85706_CLOAB/14-60),(((TCMR_STRGA/32-78,O53054_LISIV/8-54),Q59213_BACME/8-54),YPB3_LACLA/13-59))),((YWCC_BACSU/17-63,P96812_MYCTU/20-66),(QACR_STAAM/7-53,O67157_AQUAE/7-53))))),(((Y893_HAEIN/12-58,P94548_BACSU/11-57),(YHGD_BACSU/9-55,(BM3R_BACME/11-57,O08335_BACSU/12-58))),((((O66635_AQUAE/12-58,P96701_BACSU/12-58),((P95100_MYCTU/26-72,P96222_MYCTU/29-75),Q9ZN97_ECOLI/22-68)),(UIDR_ECOLI/16-62,O07001_BACSU/12-58)),(O31560_BACSU/17-63,O08377_MYCTU/24-70))))),((O27815_METTH/18-64,O34643_BACSU/8-54),(P73186_SYNY3/47-93,((O67930_AQUAE/8-54,(TTK_HAEIN/36-82,TTK_ECOLI/16-62)),O67927_AQUAE/18-64))))),((Q9Z601_NOSPU/12-57,((YBIH_ECOLI/17-62,(YTTP_BACSU/9-55,O07252_MYCTU/11-57)),(LUXR_VIBHA/21-67,O86312_MYCTU/12-57))),(O53612_MYCTU/19-64,(Y3439_MYCBO/23-69,O33187_MYCTU/24-70)))),(((O54185_STRCO/76-120,O07254_MYCTU/13-59),((((O07229_MYCTU/19-65,O53310_MYCTU/15-61),P95251_MYCTU/223-269),(O06169_MYCTU/30-76,P95251_MYCTU/19-65)),(P96839_MYCTU/15-61,((O86514_STRCO/19-65,O53323_MYCTU/22-68),O08306_NOCSI/21-64)))),(O53165_MYCTU/16-62,(O68442_9RHIZ/15-61,((ENVR_ECOLI/16-62,ACRR_ECOLI/16-62),MTRR_NEIGO/15-61))))),TETC_ECOLI/18-64),P96821_MYCTU/93-139),P72624_SYNY3/24-70),O53623_MYCTU/19-65,O53119_MYCLE/19-65);
ATL  66.9004
DNO  108
DLN  147
DID  0.43943
DPH  (((((((((((P95251_MYCTU/19-65:0.23473,O07254_MYCTU/13-59:0.40917):0.13072,((O28458_ARCFU/8-54:0.39247,O27135_METTH/17-63:0.29185):0.12262,((O86510_STRCO/15-61:0.24848,Q55363_SYNY3/17-63:0.47709):0.10544,(BETI_ECOLI/14-60:0.41344,BETI_RHIME/14-60:0.26694):0.09552):0.11990):0.05953):0.03440,((P72624_SYNY3/24-70:0.45795,O05858_MYCTU/44-90:0.38145):0.09940,(((((O66658_AQUAE/15-61:0.24629,((((O31560_BACSU/17-63:0.36854,O32228_BACSU/5-50:0.42957):0.00416,YHGD_BACSU/9-55:0.35572):0.08624,((((YPB3_LACLA/13-59:0.37082,O53054_LISIV/8-54:0.27562):0.09294,O07001_BACSU/12-58:0.34870):0.01853,((((PKSA_BACSU/14-57:0.30903,O33453_PSEPU/19-65:0.50870):0.12524,Q9Z601_NOSPU/12-57:0.31470):0.15885,((YUXN_BACSU/8-54:0.15280,YERO_BACSU/8-54:0.30531):0.15615,P94423_BACSU/8-54:0.39174):0.05067):0.06101,Q59213_BACME/8-54:0.28471):0.09111):0.05192,((YXAF_BACSU/11-58:0.14092,O34619_BACSU/10-57:0.20627):0.42356,(((YWCC_BACSU/17-63:0.45242,TETC_ECOLI/18-64:0.31284):0.16488,((Q9ZN97_ECOLI/22-68:0.42211,QACR_STAAM/7-53:0.24726):0.05298,(O85706_CLOAB/14-60:0.34019,O67157_AQUAE/7-53:0.26264):0.07989):0.05957):0.03760,((((YTTP_BACSU/9-55:0.31745,Q53772_STAAU/14-60:0.40671):0.10668,((Y893_HAEIN/12-58:0.30130,(BM3R_BACME/11-57:0.18458,O08335_BACSU/12-58:0.25953):0.14430):0.05158,((O66635_AQUAE/12-58:0.24387,P96701_BACSU/12-58:0.30753):0.16259,P94548_BACSU/11-57:0.32069):0.11484):0.06610):0.03544,(O27815_METTH/18-64:0.50795,O34643_BACSU/8-54:0.19926):0.16301):0.09916,(Q59306_CLOPA/8-54:0.12662,(O67927_AQUAE/18-64:0.29256,(TTK_HAEIN/36-82:0.20802,TTK_ECOLI/16-62:0.50431):0.34043):0.14367):0.07608):0.04106):0.08744):0.07970):0.05020):0.11144,(P73186_SYNY3/47-93:0.35322,(O67930_AQUAE/8-54:0.42634,LUXR_VIBHA/21-67:0.58997):0.10268):0.14490):0.10225):0.18034,UIDR_ECOLI/16-62:0.26384):0.19222,O53165_MYCTU/16-62:0.33877):0.07182,(Q51516_PSEAE/7-53:0.07570,Q9Z3X8_9PSED/7-53:0.18486):0.28217):0.07112,((O53623_MYCTU/19-65:0.09208,O53119_MYCLE/19-65:0.26233):0.29864,P96821_MYCTU/93-139:0.30589):0.07389):0.04910):0.04001):0.03486,((((((O24739_STRVG/15-61:0.26618,O66121_STRCO/14-60:0.18208):0.07748,Q9ZHP8_STRFR/13-59:0.17391):0.04492,AFRP_STRGR/14-60:0.24487):0.03798,O86852_STRCO/14-60:0.13342):0.16984,(O08306_NOCSI/21-64:0.23274,((P96812_MYCTU/20-66:0.46433,P96839_MYCTU/15-61:0.22828):0.09139,((O86514_STRCO/19-65:0.20204,O69500_MYCLE/17-63:0.34657):0.07515,O53323_MYCTU/22-68:0.43780):0.07222):0.04382):0.03500):0.04572,(((((O08377_MYCTU/24-70:0.27424,O07229_MYCTU/19-65:0.33765):0.04065,(((ENVR_ECOLI/16-62:0.24353,ACRR_ECOLI/16-62:0.30593):0.12467,MTRR_NEIGO/15-61:0.25508):0.12644,O68442_9RHIZ/15-61:0.38394):0.06783):0.09764,((O54102_STRCO/20-66:0.32986,Q9ZFC1_MYCSM/18-64:0.27663):0.06296,P95251_MYCTU/223-269:0.42704):0.10631):0.09330,((Y3439_MYCBO/23-69:0.25176,O33187_MYCTU/24-70:0.44489):0.13245,((O86312_MYCTU/12-57:0.35159,YBIH_ECOLI/17-62:0.35091):0.07841,O07252_MYCTU/11-57:0.30176):0.10946):0.04081):0.02729,((((Q53901_STRCO/36-82:0.21296,O52558_AMYMD/34-80:0.23745):0.16861,(((((TER5_ECOLI/9-55:0.41779,TER4_ECOLI/8-54:0.13727):0.11878,TER3_ECOLI/9-55:0.22187):0.15520,Q9Z480_9RHIZ/8-54:0.13077):0.10822,Y1388_MYCBO/21-67:0.39566):0.03542,(O53295_MYCTU/35-80:0.42859,O87854_STRCO/12-58:0.27148):0.09904):0.05519):0.11783,((P95100_MYCTU/26-72:0.39083,Y790_MYCBO/35-81:0.34558):0.07539,YDH1_XANAU/20-66:0.50513):0.12054):0.09422,((O53310_MYCTU/15-61:0.30598,Q9Z551_STRCO/18-64:0.31410):0.12814,Q9ZGB7_STRCY/16-62:0.18434):0.05028):0.03146):0.06392):0.05875):0.03578,(P96222_MYCTU/29-75:0.37665,(O54185_STRCO/76-120:0.25094,O69909_STRCO/12-58:0.45857):0.08899):0.17780):0.08484,O06169_MYCTU/30-76:0.36001):0.03828,P96856_MYCTU/21-67:0.33691):0.04940,O53612_MYCTU/19-64:0.36483):0.13943,((O53317_MYCTU/26-72:0.33236,Y1581_MYCBO/25-71:0.29015):0.10638,Q51730_PSEFL/22-68:0.47913):0.11153):0.04404,Q54288_STRHY/25-71:0.25396):0.04668,O50423_MYCTU/23-69:0.33866,P72185_9ACTO/45-91:0.12619);
DTP  (((((((((((P95251_MYCTU/19-65,O07254_MYCTU/13-59),((O28458_ARCFU/8-54,O27135_METTH/17-63),((O86510_STRCO/15-61,Q55363_SYNY3/17-63),(BETI_ECOLI/14-60,BETI_RHIME/14-60)))),((P72624_SYNY3/24-70,O05858_MYCTU/44-90),(((((O66658_AQUAE/15-61,((((O31560_BACSU/17-63,O32228_BACSU/5-50),YHGD_BACSU/9-55),((((YPB3_LACLA/13-59,O53054_LISIV/8-54),O07001_BACSU/12-58),((((PKSA_BACSU/14-57,O33453_PSEPU/19-65),Q9Z601_NOSPU/12-57),((YUXN_BACSU/8-54,YERO_BACSU/8-54),P94423_BACSU/8-54)),Q59213_BACME/8-54)),((YXAF_BACSU/11-58,O34619_BACSU/10-57),(((YWCC_BACSU/17-63,TETC_ECOLI/18-64),((Q9ZN97_ECOLI/22-68,QACR_STAAM/7-53),(O85706_CLOAB/14-60,O67157_AQUAE/7-53))),((((YTTP_BACSU/9-55,Q53772_STAAU/14-60),((Y893_HAEIN/12-58,(BM3R_BACME/11-57,O08335_BACSU/12-58)),((O66635_AQUAE/12-58,P96701_BACSU/12-58),P94548_BACSU/11-57))),(O27815_METTH/18-64,O34643_BACSU/8-54)),(Q59306_CLOPA/8-54,(O67927_AQUAE/18-64,(TTK_HAEIN/36-82,TTK_ECOLI/16-62)))))))),(P73186_SYNY3/47-93,(O67930_AQUAE/8-54,LUXR_VIBHA/21-67)))),UIDR_ECOLI/16-62),O53165_MYCTU/16-62),(Q51516_PSEAE/7-53,Q9Z3X8_9PSED/7-53)),((O53623_MYCTU/19-65,O53119_MYCLE/19-65),P96821_MYCTU/93-139)))),((((((O24739_STRVG/15-61,O66121_STRCO/14-60),Q9ZHP8_STRFR/13-59),AFRP_STRGR/14-60),O86852_STRCO/14-60),(O08306_NOCSI/21-64,((P96812_MYCTU/20-66,P96839_MYCTU/15-61),((O86514_STRCO/19-65,O69500_MYCLE/17-63),O53323_MYCTU/22-68)))),(((((O08377_MYCTU/24-70,O07229_MYCTU/19-65),(((ENVR_ECOLI/16-62,ACRR_ECOLI/16-62),MTRR_NEIGO/15-61),O68442_9RHIZ/15-61)),((O54102_STRCO/20-66,Q9ZFC1_MYCSM/18-64),P95251_MYCTU/223-269)),((Y3439_MYCBO/23-69,O33187_MYCTU/24-70),((O86312_MYCTU/12-57,YBIH_ECOLI/17-62),O07252_MYCTU/11-57))),((((Q53901_STRCO/36-82,O52558_AMYMD/34-80),(((((TER5_ECOLI/9-55,TER4_ECOLI/8-54),TER3_ECOLI/9-55),Q9Z480_9RHIZ/8-54),Y1388_MYCBO/21-67),(O53295_MYCTU/35-80,O87854_STRCO/12-58))),((P95100_MYCTU/26-72,Y790_MYCBO/35-81),YDH1_XANAU/20-66)),((O53310_MYCTU/15-61,Q9Z551_STRCO/18-64),Q9ZGB7_STRCY/16-62))))),(P96222_MYCTU/29-75,(O54185_STRCO/76-120,O69909_STRCO/12-58))),O06169_MYCTU/30-76),P96856_MYCTU/21-67),O53612_MYCTU/19-64),((O53317_MYCTU/26-72,Y1581_MYCBO/25-71),Q51730_PSEFL/22-68)),Q54288_STRHY/25-71),O50423_MYCTU/23-69,P72185_9ACTO/45-91);
DTL  43.9543
RID  0.307531
RPH  ((((((((((((((((((BETI_ECOLI/14-60:0.55618,BETI_RHIME/14-60:0.43931):0.10152,(O33453_PSEPU/19-65:0.74573,(O86510_STRCO/15-61:0.47201,Q55363_SYNY3/17-63:0.64697):0.07671):0.11364):0.10793,(PKSA_BACSU/14-57:0.57443,(Q53772_STAAU/14-60:0.57284,YDH1_XANAU/20-66:0.61514):0.13988):0.11242):0.09783,(((P96856_MYCTU/21-67:0.37299,Y790_MYCBO/35-81:0.61500):0.08013,((O69909_STRCO/12-58:0.57102,O54102_STRCO/20-66:0.29919):0.19287,Q9ZFC1_MYCSM/18-64:0.54460):0.26713):0.01680,((Q54288_STRHY/25-71:0.44223,(O50423_MYCTU/23-69:0.37960,P72185_9ACTO/45-91:0.20992):0.05092):0.14075,((O53317_MYCTU/26-72:0.35546,Q51730_PSEFL/22-68:0.55335):0.14109,Y1581_MYCBO/25-71:0.46011):0.09978):0.38073):0.20266):0.19895,(O53612_MYCTU/19-64:0.53186,(((LUXR_VIBHA/21-67:0.65099,O86312_MYCTU/12-57:0.54909):0.12766,Q9Z601_NOSPU/12-57:0.49648):0.06752,((Y3439_MYCBO/23-69:0.40325,O33187_MYCTU/24-70:0.47434):0.17558,(YBIH_ECOLI/17-62:0.55392,(YTTP_BACSU/9-55:0.63644,O07252_MYCTU/11-57:0.52150):0.08989):0.26130):0.11579):0.08990):0.14726):0.11507,(((UIDR_ECOLI/16-62:0.33664,O07001_BACSU/12-58:0.56015):0.17986,(O86852_STRCO/14-60:0.18942,((AFRP_STRGR/14-60:0.24687,(O24739_STRVG/15-61:0.53674,O66121_STRCO/14-60:0.23726):0.16196):0.05368,Q9ZHP8_STRFR/13-59:0.25081):0.06386):0.31867):0.00000,(((O69500_MYCLE/17-63:0.43197,O27135_METTH/17-63:0.50886):0.18919,O05858_MYCTU/44-90:0.47451):0.07719,Q59306_CLOPA/8-54:0.43479):0.04030):0.03713):0.11031,((QACR_STAAM/7-53:0.49665,((O67157_AQUAE/7-53:0.27569,((YPB3_LACLA/13-59:0.63204,O85706_CLOAB/14-60:0.29439):0.12964,(YXAF_BACSU/11-58:0.19613,O34619_BACSU/10-57:0.05277):0.44276):0.37642):0.01606,(((P95100_MYCTU/26-72:0.51971,P96222_MYCTU/29-75:0.42087):0.41823,((O66635_AQUAE/12-58:0.22504,P96701_BACSU/12-58:0.52852):0.18565,Q9ZN97_ECOLI/22-68:0.64536):0.11395):0.05969,(O53054_LISIV/8-54:0.33147,Q59213_BACME/8-54:0.37163):0.15937):0.09195):0.09091):0.06777,(YWCC_BACSU/17-63:0.85845,P96812_MYCTU/20-66:0.56868):0.08604):0.14461):0.09131,(((Y893_HAEIN/12-58:0.55140,P94548_BACSU/11-57:0.39558):0.20916,(YHGD_BACSU/9-55:0.32513,(BM3R_BACME/11-57:0.11757,O08335_BACSU/12-58:0.25084):0.41337):0.11919):0.07137,((O31560_BACSU/17-63:0.55787,O08377_MYCTU/24-70:0.39585):0.22192,(O66658_AQUAE/15-61:0.25121,O32228_BACSU/5-50:0.68453):0.19343):0.05689):0.04516):0.06924,((O27815_METTH/18-64:0.54715,O34643_BACSU/8-54:0.17807):0.24335,(P73186_SYNY3/47-93:0.54040,((O67930_AQUAE/8-54:0.77359,(TTK_HAEIN/36-82:0.27001,TTK_ECOLI/16-62:0.23848):0.56953):0.16815,O67927_AQUAE/18-64:0.18220):0.15839):0.09424):0.16962):0.06963,(((Q51516_PSEAE/7-53:0.23650,Q9Z3X8_9PSED/7-53:0.00000):0.66463,P94423_BACSU/8-54:0.45667):0.03326,(YUXN_BACSU/8-54:0.12862,YERO_BACSU/8-54:0.28604):0.22482):0.16370):0.00000,O28458_ARCFU/8-54:0.62558):0.16043,((((P95251_MYCTU/223-269:0.65189,O53310_MYCTU/15-61:0.41700):0.03258,O07229_MYCTU/19-65:0.53169):0.21616,(O06169_MYCTU/30-76:0.26261,P95251_MYCTU/19-65:0.39037):0.16220):0.13257,(P96839_MYCTU/15-61:0.51719,((O86514_STRCO/19-65:0.34025,O53323_MYCTU/22-68:0.40682):0.29236,O08306_NOCSI/21-64:0.28833):0.09815):0.11465):0.08297):0.06470,TETC_ECOLI/18-64:0.64031):0.08285,(((ENVR_ECOLI/16-62:0.41871,ACRR_ECOLI/16-62:0.20588):0.10927,MTRR_NEIGO/15-61:0.33143):0.20592,(O68442_9RHIZ/15-61:0.50805,((((Y1388_MYCBO/21-67:0.68874,(Q53901_STRCO/36-82:0.27304,O52558_AMYMD/34-80:0.44777):0.43227):0.08780,(Q9Z480_9RHIZ/8-54:0.06075,(((TER5_ECOLI/9-55:0.43759,TER4_ECOLI/8-54:0.00000):0.21100,TER3_ECOLI/9-55:0.12408):0.11785,Q9Z551_STRCO/18-64:0.70384):0.09215):0.08878):0.18189,(O53295_MYCTU/35-80:0.85124,O87854_STRCO/12-58:0.44639):0.26553):0.25928,Q9ZGB7_STRCY/16-62:0.30389):0.22490):0.01828):0.06900):0.10396,((O54185_STRCO/76-120:0.57955,O07254_MYCTU/13-59:0.86283):0.20812,O53165_MYCTU/16-62:0.56917):0.00000):0.11493,P96821_MYCTU/93-139:0.54876):0.33791,P72624_SYNY3/24-70:0.35634):0.42779,O53623_MYCTU/19-65:0.00984,O53119_MYCLE/19-65:0.32480);
RTP  ((((((((((((((((((BETI_ECOLI/14-60,BETI_RHIME/14-60),(O33453_PSEPU/19-65,(O86510_STRCO/15-61,Q55363_SYNY3/17-63))),(PKSA_BACSU/14-57,(Q53772_STAAU/14-60,YDH1_XANAU/20-66))),(((P96856_MYCTU/21-67,Y790_MYCBO/35-81),((O69909_STRCO/12-58,O54102_STRCO/20-66),Q9ZFC1_MYCSM/18-64)),((Q54288_STRHY/25-71,(O50423_MYCTU/23-69,P72185_9ACTO/45-91)),((O53317_MYCTU/26-72,Q51730_PSEFL/22-68),Y1581_MYCBO/25-71)))),(O53612_MYCTU/19-64,(((LUXR_VIBHA/21-67,O86312_MYCTU/12-57),Q9Z601_NOSPU/12-57),((Y3439_MYCBO/23-69,O33187_MYCTU/24-70),(YBIH_ECOLI/17-62,(YTTP_BACSU/9-55,O07252_MYCTU/11-57)))))),(((UIDR_ECOLI/16-62,O07001_BACSU/12-58),(O86852_STRCO/14-60,((AFRP_STRGR/14-60,(O24739_STRVG/15-61,O66121_STRCO/14-60)),Q9ZHP8_STRFR/13-59))),(((O69500_MYCLE/17-63,O27135_METTH/17-63),O05858_MYCTU/44-90),Q59306_CLOPA/8-54))),((QACR_STAAM/7-53,((O67157_AQUAE/7-53,((YPB3_LACLA/13-59,O85706_CLOAB/14-60),(YXAF_BACSU/11-58,O34619_BACSU/10-57))),(((P95100_MYCTU/26-72,P96222_MYCTU/29-75),((O66635_AQUAE/12-58,P96701_BACSU/12-58),Q9ZN97_ECOLI/22-68)),(O53054_LISIV/8-54,Q59213_BACME/8-54)))),(YWCC_BACSU/17-63,P96812_MYCTU/20-66))),(((Y893_HAEIN/12-58,P94548_BACSU/11-57),(YHGD_BACSU/9-55,(BM3R_BACME/11-57,O08335_BACSU/12-58))),((O31560_BACSU/17-63,O08377_MYCTU/24-70),(O66658_AQUAE/15-61,O32228_BACSU/5-50)))),((O27815_METTH/18-64,O34643_BACSU/8-54),(P73186_SYNY3/47-93,((O67930_AQUAE/8-54,(TTK_HAEIN/36-82,TTK_ECOLI/16-62)),O67927_AQUAE/18-64)))),(((Q51516_PSEAE/7-53,Q9Z3X8_9PSED/7-53),P94423_BACSU/8-54),(YUXN_BACSU/8-54,YERO_BACSU/8-54))),O28458_ARCFU/8-54),((((P95251_MYCTU/223-269,O53310_MYCTU/15-61),O07229_MYCTU/19-65),(O06169_MYCTU/30-76,P95251_MYCTU/19-65)),(P96839_MYCTU/15-61,((O86514_STRCO/19-65,O53323_MYCTU/22-68),O08306_NOCSI/21-64)))),TETC_ECOLI/18-64),(((ENVR_ECOLI/16-62,ACRR_ECOLI/16-62),MTRR_NEIGO/15-61),(O68442_9RHIZ/15-61,((((Y1388_MYCBO/21-67,(Q53901_STRCO/36-82,O52558_AMYMD/34-80)),(Q9Z480_9RHIZ/8-54,(((TER5_ECOLI/9-55,TER4_ECOLI/8-54),TER3_ECOLI/9-55),Q9Z551_STRCO/18-64))),(O53295_MYCTU/35-80,O87854_STRCO/12-58)),Q9ZGB7_STRCY/16-62)))),((O54185_STRCO/76-120,O07254_MYCTU/13-59),O53165_MYCTU/16-62)),P96821_MYCTU/93-139),P72624_SYNY3/24-70),O53623_MYCTU/19-65,O53119_MYCLE/19-65);
RTL  63.7852
LNK  ACRR_ECOLI/16-62:P34000:U00734
LNK  AFRP_STRGR/14-60:Q9ZN78:D49782
LNK  BETI_ECOLI/14-60:P17446:X52905
LNK  BETI_RHIME/14-60:O69786:U39940
LNK  BM3R_BACME/11-57:P43506:S87512
LNK  ENVR_ECOLI/16-62:P31676:X57948
LNK  LUXR_VIBHA/21-67:P21308:M55260
LNK  MTRR_NEIGO/15-61:P39897:Z25797
LNK  O05858_MYCTU/44-90:O05858:BX842582
LNK  O06169_MYCTU/30-76:O06169:BX842580
LNK  O07001_BACSU/12-58:O07001:Z94043
LNK  O07229_MYCTU/19-65:O07229:BX842573
LNK  O07252_MYCTU/11-57:O07252:BX842573
LNK  O07254_MYCTU/13-59:O07254:BX842573
LNK  O08306_NOCSI/21-64:O08306:Z93338
LNK  O08335_BACSU/12-58:O08335:U93874
LNK  O08377_MYCTU/24-70:O08377:BX842577
LNK  O24739_STRVG/15-61:O24739:AB001609
LNK  O27135_METTH/17-63:O27135:AE000877
LNK  O27815_METTH/18-64:O27815:AE000933
LNK  O28458_ARCFU/8-54:O28458:AE000977
LNK  O31560_BACSU/17-63:O31560:Z99108
LNK  O32228_BACSU/5-50:O32228:Z99121
LNK  O33187_MYCTU/24-70:O33187:BX842577
LNK  O33453_PSEPU/19-65:O33453:U24215
LNK  O34619_BACSU/10-57:O34619:AB000617
LNK  O34643_BACSU/8-54:O34643:AF017113
LNK  O50423_MYCTU/23-69:O50423:BX842575
LNK  O52558_AMYMD/34-80:O52558:AF040570
LNK  O53054_LISIV/8-54:O53054:Y07639
LNK  O53119_MYCLE/19-65:O53119:AL022118
LNK  O53165_MYCTU/16-62:O53165:BX842576
LNK  O53295_MYCTU/35-80:O53295:BX842581
LNK  O53310_MYCTU/15-61:O53310:BX842582
LNK  O53317_MYCTU/26-72:O53317:BX842582
LNK  O53323_MYCTU/22-68:O53323:BX842582
LNK  O53612_MYCTU/19-64:O53612:BX842572
LNK  O53623_MYCTU/19-65:O53623:BX842572
LNK  O54102_STRCO/20-66:O54102:AL939125
LNK  O54185_STRCO/76-120:O54185:AL939125
LNK  O66121_STRCO/14-60:O66121:AB000384
LNK  O66635_AQUAE/12-58:O66635:AE000682
LNK  O66658_AQUAE/15-61:O66658:AE000683
LNK  O67157_AQUAE/7-53:O67157:AE000721
LNK  O67927_AQUAE/18-64:O67927:AE000776
LNK  O67930_AQUAE/8-54:O67930:AE000776
LNK  O68442_9RHIZ/15-61:O68442:AF039653
LNK  O69500_MYCLE/17-63:O69500:AL022486
LNK  O69909_STRCO/12-58:O69909:AL939124
LNK  O85706_CLOAB/14-60:O85706:AF072735
LNK  O86312_MYCTU/12-57:O86312:BX842575
LNK  O86510_STRCO/15-61:O86510:AL939124
LNK  O86514_STRCO/19-65:O86514:AL939124
LNK  O86852_STRCO/14-60:O86852:AJ007731
LNK  O87854_STRCO/12-58:O87854:AL939128
LNK  P72185_9ACTO/45-91:P72185:U51164
LNK  P72624_SYNY3/24-70:P72624:BA000022
LNK  P73186_SYNY3/47-93:P73186:BA000022
LNK  P94423_BACSU/8-54:P94423:D50453
LNK  P94548_BACSU/11-57:P94548:Z75208
LNK  P95100_MYCTU/26-72:P95100:BX842581
LNK  P95251_MYCTU/19-65:P95251:BX842578
LNK  P95251_MYCTU/223-269:P95251:BX842578
LNK  P96222_MYCTU/29-75:P96222:BX842584
LNK  P96701_BACSU/12-58:P96701:AB001488
LNK  P96812_MYCTU/20-66:P96812:BX842572
LNK  P96821_MYCTU/93-139:P96821:BX842572
LNK  P96839_MYCTU/15-61:P96839:BX842583
LNK  P96856_MYCTU/21-67:P96856:BX842583
LNK  PKSA_BACSU/14-57:O34381:Z99112
LNK  Q51516_PSEAE/7-53:Q51516:X66592
LNK  Q51730_PSEFL/22-68:Q51730:U41818
LNK  Q53772_STAAU/14-60:Q53772:L43082
LNK  Q53901_STRCO/36-82:Q53901:M64683
LNK  Q54288_STRHY/25-71:Q54288:X86780
LNK  Q55363_SYNY3/17-63:Q55363:BA000022
LNK  Q59213_BACME/8-54:Q59213:S79230
LNK  Q59306_CLOPA/8-54:Q59306:Z28353
LNK  Q9Z3X8_9PSED/7-53:Q9Z3X8:AB014758
LNK  Q9Z480_9RHIZ/8-54:Q9Z480:AF090987
LNK  Q9Z551_STRCO/18-64:Q9Z551:AL939126
LNK  Q9Z601_NOSPU/12-57:Q9Z601:AF116873
LNK  Q9ZFC1_MYCSM/18-64:Q9ZFC1:AF107047
LNK  Q9ZGB7_STRCY/16-62:Q9ZGB7:AF080235
LNK  Q9ZHP8_STRFR/13-59:Q9ZHP8:AF055922
LNK  Q9ZN97_ECOLI/22-68:Q9ZN97:AB020531
LNK  QACR_STAAM/7-53:P23217:AP003367
LNK  TCMR_STRGA/32-78:P39885:
LNK  TER3_ECOLI/9-55:P03039:M36272
LNK  TER4_ECOLI/8-54:P09164:X01083
LNK  TER5_ECOLI/9-55:P21337:X14035
LNK  TETC_ECOLI/18-64:P28815:J01830
LNK  TTK_ECOLI/16-62:P06969:X01714
LNK  TTK_HAEIN/36-82:P29280:U32776
LNK  UIDR_ECOLI/16-62:Q59431:M14641
LNK  Y1388_MYCBO/21-67:P67435:BX248338
LNK  Y1581_MYCBO/25-71:P67437:BX248339
LNK  Y3439_MYCBO/23-69:P67443:BX248346
LNK  Y790_MYCBO/35-81:P67433:BX248336
LNK  Y893_HAEIN/12-58:P44923:U32771
LNK  YBIH_ECOLI/17-62:P41037:D90716
LNK  YCFQ_ECOLI/24-70:P75952:
LNK  YDH1_XANAU/20-66:P22645:M26950
LNK  YERO_BACSU/8-54:O31500:Z99107
LNK  YHGD_BACSU/9-55:P32398:M97208
LNK  YIJC_ECOLI/15-62:P27307:
LNK  YJGJ_ECOLI/21-67:P39334:
LNK  YPB3_LACLA/13-59:P42097:X60456
LNK  YTTP_BACSU/9-55:O34970:AF008220
LNK  YUXN_BACSU/8-54:P40950:AJ223978
LNK  YWCC_BACSU/17-63:P39601:X73124
LNK  YXAF_BACSU/11-58:P42105:AB005554
AMK  xxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q51730_PSEFL/22-68
ASQ  IIISAIETLK.ECGYSGLSIEAVARRAGASKPTIYRWWG.NKAALIAEV
DSQ  ATCATCATCTCCGCTATAGAAACACTCAAG...GAGTGCGGTTATTCAGGGTTGAGTATCGAGGCTGTGGCTCGCCGTGCCGGCGCGAGCAAGCCGACCATCTATCGATGGTGGGGT...AACAAGGCGGCTTTGATCGCCGAAGTC
TRN  10010111110111001
NAM  P72185_9ACTO/45-91
ASQ  ILDAGWRELA.GAGYAGLTFEAVAERAHTGKAALYRRWP.NKESLVLAV
DSQ  ATCTTGGACGCCGGATGGCGCGAACTCGCC...GGTGCCGGCTACGCCGGACTCACCTTCGAGGCAGTGGCCGAGCGCGCCCACACCGGCAAGGCCGCCCTCTACCGGCGCTGGCCC...AACAAGGAGTCGCTGGTGCTGGCCGTG
TRN  11011111101111111
NAM  O50423_MYCTU/23-69
ASQ  LYDATLAELE.SAGYGGLTMEGIAARAQTGKAALYRRWA.GKRELVLAA
DSQ  CTCTACGATGCGACGCTGGCCGAACTCGAA...TCCGCCGGATACGGCGGGCTGACCATGGAAGGCATCGCGGCACGCGCCCAAACCGGCAAAGCCGCGTTGTATCGGCGGTGGGCC...GGCAAACGTGAGCTGGTGCTGGCCGCG
TRN  11011101101011011
NAM  Q54288_STRHY/25-71
ASQ  ITEAAFAELA.DAGYARMSMESVARRAGVGKAALYRRWP.SKQAMVTEL
DSQ  ATCACCGAGGCGGCCTTCGCCGAACTCGCC...GACGCCGGGTACGCGCGGATGTCGATGGAGTCGGTGGCCCGGCGGGCCGGCGTGGGCAAGGCCGCGCTCTACCGGCGCTGGCCC...TCGAAGCAGGCGATGGTCACCGAACTG
TRN  11011111101111111
NAM  Y1581_MYCBO/25-71
ASQ  LLAVTLRLLQ.EHGYDRLTVDAVAASARASKATVYRRWP.SKAELVLAA
DSQ  TTACTGGCGGTGACACTACGGCTGCTGCAG...GAGCACGGTTATGACCGGCTAACAGTGGATGCCGTTGCGGCGAGCGCCCGCGCCAGCAAGGCAACGGTCTACCGGCGCTGGCCG...TCGAAAGCCGAATTGGTGCTGGCCGCG
TRN  11011101101011010
NAM  O53317_MYCTU/26-72
ASQ  ILSATAELLV.QIGYSNLSLAAVAERAGTTKSALYRRWS.SKAELVHEA
DSQ  ATCCTGTCGGCGACGGCGGAACTGCTTGTG...CAGATCGGGTATTCGAACCTCAGCTTGGCCGCGGTCGCCGAACGCGCCGGCACCACCAAATCGGCGTTGTACCGGCGGTGGTCG...AGCAAGGCCGAACTAGTGCACGAGGCC
TRN  11011101101011011
NAM  Q9ZFC1_MYCSM/18-64
ASQ  LLDAAEALMI.DEGYAAVTSRRVAERAGLKPQLVHYYFR.TMDDLFLAV
DSQ  CTGCTCGACGCAGCCGAGGCGCTCATGATC...GACGAGGGCTACGCGGCCGTCACGTCCCGCCGGGTCGCGGAGCGGGCCGGCCTCAAGCCGCAACTGGTGCACTACTACTTCCGC...ACCATGGACGATCTGTTCCTCGCGGTG
TRN  11011111101111111
NAM  O54102_STRCO/20-66
ASQ  LIDAAEELLE.EGGAEALTAGAVAARAGIARNSIYRYFN.SIDDLLELV
DSQ  CTGATTGACGCGGCCGAGGAGCTCCTGGAA...GAGGGCGGTGCCGAAGCCCTCACAGCCGGAGCGGTTGCCGCGCGAGCCGGGATCGCCCGCAACAGCATCTACCGCTACTTCAAC...TCCATCGACGACCTGCTCGAACTCGTC
TRN  11011111101111111
NAM  O69909_STRCO/12-58
ASQ  LLDAARSLLS.DGGTEALTFPALAERTGLARSSVYEYFR.SRAAVVEEL
DSQ  CTGCTGGACGCGGCACGCTCCCTGCTGTCC...GACGGCGGAACGGAGGCGCTGACCTTCCCCGCCCTCGCCGAACGGACGGGTCTCGCCCGCTCCTCCGTCTACGAGTACTTCCGG...TCGCGGGCGGCGGTGGTCGAGGAGCTG
TRN  11011111101111111
NAM  Y790_MYCBO/35-81
ASQ  VLAAAMATLR.EKSYADLTVRLVAARAKVAPATAYTYFS.SKNHLIAEV
DSQ  GTGCTAGCTGCCGCCATGGCGACCCTGCGG...GAGAAGTCATACGCCGACCTGACGGTGCGCCTGGTGGCGGCCCGCGCCAAGGTAGCCCCGGCGACGGCCTACACATACTTCTCG...TCGAAGAACCATCTGATCGCCGAGGTC
TRN  11011111101111101
NAM  P96856_MYCTU/21-67
ASQ  ILDATMAIAS.KGGYEAVQMRAVADRADVAVGTLYRYFP.SKVHLLVSA
DSQ  ATCTTGGACGCCACCATGGCTATCGCGTCC...AAAGGCGGCTATGAGGCGGTGCAGATGCGCGCCGTCGCCGACCGCGCCGACGTCGCGGTTGGCACGCTGTACCGGTACTTCCCG...TCGAAGGTGCATCTGCTGGTGTCGGCG
TRN  11011101101011011
NAM  YDH1_XANAU/20-66
ASQ  ILDVALELLE.TEGEFGLTMRQVATQADMSLSNVQYYFK.SEDLLLVAM
DSQ  ATCCTGGATGTCGCGCTCGAATTGCTTGAG...ACAGAGGGTGAGTTTGGTTTGACGATGAGGCAGGTGGCAACGCAAGCGGACATGTCCCTGAGCAACGTTCAGTACTATTTCAAG...TCCGAGGACCTGCTCCTCGTGGCCATG
TRN  10010101100011011
NAM  O32228_BACSU/5-50
ASQ  ILAETFRLIK.QKGFS-FTMNDLAAALGTSKRTLYAYYS.SKDQLVEAV
DSQ  ATTCTGGCGGAAACCTTCCGGCTGATCAAG...CAGAAAGGATTTTCA---TTTACGATGAATGATTTGGCGGCAGCGCTGGGAACGAGCAAGCGGACGCTCTATGCATATTATTCA...TCTAAAGATCAGCTTGTTGAGGCGGTT
TRN  11011101101011001
NAM  O07254_MYCTU/13-59
ASQ  IVAASARVFI.AHGYQRTQVQDVADALALAKGTLYGYAQ.GKAALFAAA
DSQ  ATTGTCGCCGCGTCGGCGCGGGTGTTCATC...GCCCACGGTTACCAGCGCACCCAGGTGCAGGACGTGGCCGACGCACTCGCCCTGGCCAAAGGCACGCTGTATGGCTACGCCCAG...GGCAAGGCTGCGCTGTTCGCGGCGGCG
TRN  11011101101011011
NAM  O87854_STRCO/12-58
ASQ  ILDAAAELLL.AGDAETFSVRKLAASLGTDSSSLYRHFR.NKTELLRAV
DSQ  ATCCTGGACGCCGCGGCGGAGCTGCTGCTC...GCGGGCGACGCCGAGACGTTCAGCGTGCGCAAGCTCGCCGCGTCGCTGGGGACCGACTCCTCCAGCCTCTACCGGCACTTCCGC...AACAAGACCGAACTGCTGCGCGCGGTC
TRN  11011111101111111
NAM  Q9Z480_9RHIZ/8-54
ASQ  IVDEALRLLN.EVGIDKLSTRKLAERLGVQQPALYWHFR.NKAELLDAI
DSQ  ATTGTCGATGAGGCCCTGCGGCTCCTGAAC...GAGGTGGGAATAGACAAGCTGTCCACCCGCAAGCTCGCGGAACGGCTGGGCGTCCAGCAGCCGGCGCTCTACTGGCACTTCCGC...AACAAGGCGGAATTGCTCGACGCCATC
TRN  10010111100111011
NAM  TER3_ECOLI/9-55
ASQ  VIRTALELLN.DVGMEGLTTRRLAERLGVQQPALYWHFK.NKRALLDAL
DSQ  GTGATCCGAACCGCGCTCGAACTGCTTAAC...GACGTGGGCATGGAAGGTCTAACGACGCGCCGACTGGCTGAGCGCCTCGGGGTGCAACAGCCAGCGCTCTACTGGCATTTCAAG...AACAAGCGTGCGTTGCTCGACGCACTT
TRN  11011111101111111
NAM  TER4_ECOLI/8-54
ASQ  VIDAALELLN.ETGIDGLTTRKLAQKLGIEQPTLYWHVK.NKRALLDAL
DSQ  GTTATTGATGCGGCACTGGAACTGCTGAAT...GAGACAGGGATTGACGGGCTGACGACCCGCAAGCTGGCGCAGAAGCTGGGAATAGAACAGCCGACACTTTACTGGCATGTGAAA...AATAAACGGGCGTTACTGGATGCGCTG
TRN  10010101100011010
NAM  TER5_ECOLI/9-55
ASQ  VISMALTLLD.SEGLEGLTTRKLAQSLKIEQPTLYWHVR.NKQTLMNML
DSQ  GTAATTTCAATGGCGCTCACCCTGCTGGAC...AGCGAAGGGCTAGAGGGCTTGACTACGCGTAAGCTGGCGCAGTCCCTAAAAATTGAGCAACCGACTCTGTATTGGCACGTGCGC...AACAAGCAGACTCTTATGAACATGCTT
TRN  11011101101011001
NAM  Q9Z551_STRCO/18-64
ASQ  IVATARELAE.QQGWDAVTTRRLAERIEYSQPVLYSHFR.GKREIIGAV
DSQ  ATCGTGGCGACGGCCCGTGAACTCGCCGAG...CAGCAGGGCTGGGACGCGGTCACCACCCGCCGGCTCGCCGAGCGCATCGAGTACAGCCAGCCCGTCCTCTACAGCCACTTCCGC...GGCAAACGCGAGATCATCGGCGCCGTC
TRN  11011101111011011
NAM  O52558_AMYMD/34-80
ASQ  IVATAVRVLD.AEGDAKFSMRLLAEELNVTPMSVYWYVA.NKDDLLELA
DSQ  ATCGTCGCCACCGCGGTCCGCGTCCTCGAC...GCCGAGGGCGACGCGAAGTTCTCGATGCGGCTGCTGGCCGAGGAACTCAACGTGACCCCGATGTCGGTGTACTGGTACGTCGCG...AACAAGGACGACCTGCTCGAGCTGGCC
TRN  11011111101111111
NAM  Q53901_STRCO/36-82
ASQ  IVVTALGILD.AEGLDALSMRRLAQELKTGHASLYAHVG.NRDELLDLV
DSQ  ATCGTCGTCACGGCGCTCGGCATCCTCGAC...GCCGAGGGACTCGACGCCCTGAGCATGCGGCGGCTCGCGCAGGAGCTGAAGACCGGACACGCCTCGCTGTACGCGCACGTGGGG...AACCGGGACGAGCTGCTCGACCTCGTC
TRN  11011111101111111
NAM  Y1388_MYCBO/21-67
ASQ  IISGAFELAQ.QVSIDNLSMPLLGKHLGVGVTSIYWYFR.KKDDLLNAM
DSQ  ATCATCAGCGGCGCATTCGAACTCGCCCAG...CAGGTATCGATAGACAACTTGAGCATGCCATTGCTCGGCAAACACCTTGGCGTCGGGGTCACCAGCATCTACTGGTACTTCCGC...AAGAAGGACGATCTGCTCAACGCGATG
TRN  10010101100011011
NAM  O53165_MYCTU/16-62
ASQ  ILDGARRCFA.EYGYDKATVRRLEQAIGMSRGAIFHHFR.DKDALFFAL
DSQ  ATCCTCGACGGTGCGCGCCGTTGCTTTGCC...GAATACGGCTATGACAAGGCCACGGTCCGGCGCCTGGAACAGGCAATCGGGATGTCGCGCGGTGCGATCTTTCACCACTTCCGC...GACAAGGACGCGCTGTTTTTCGCGCTG
TRN  11011111101111111
NAM  O54185_STRCO/76-120
ASQ  ILATARRELG.-RNPD-TTLEELARAAGVVRRTLFGHFP.GRAALLEAL
DSQ  ATCCTGGCCACCGCCCGCCGGGAGCTGGGG...---CGGAACCCGGAC---ACCACGCTGGAGGAGCTGGCCCGCGCCGCCGGTGTCGTACGGCGTACCCTCTTCGGCCACTTCCCG...GGGCGTGCGGCGCTGCTCGAGGCCCTC
TRN  11011111101111111
NAM  TTK_ECOLI/16-62
ASQ  LQSLALMLES.SDGSQRITTAKLAASVGVSEAALYRHFP.SKTRMFDSL
DSQ  CTTCAGTCTCTGGCGCTGATGCTGGAATCC...AGCGATGGAAGCCAACGTATCACGACGGCAAAACTGGCCGCCTCTGTCGGCGTTTCCGAAGCGGCACTGTATCGCCACTTCCCC...AGTAAGACCCGCATGTTCGATAGCCTG
TRN  11011101101011011
NAM  TTK_HAEIN/36-82
ASQ  LTVLIHMLHS.ERGMERMTTARLAKEVGVSEAALYRYFP.SKTKMFEAL
DSQ  CTTACAGTATTGATACATATGCTTCATTCT...GAACGTGGAATGGAAAGAATGACAACCGCTCGTCTAGCAAAAGAAGTTGGTGTGTCGGAAGCTGCGTTATATCGTTACTTTCCA...AGCAAAACAAAAATGTTTGAAGCACTA
TRN  10010101110011010
NAM  O08335_BACSU/12-58
ASQ  IMKASVSLFT.ERGFDATTIPMIAERAHVGTGTIYRYFD.SKETLVNVL
DSQ  ATTATGAAAGCGTCAGTCTCACTTTTTACG...GAAAGGGGTTTTGACGCTACCACTATTCCTATGATAGCTGAACGTGCTCATGTAGGGACAGGAACGATCTATCGTTATTTTGAC...AGCAAAGAAACACTCGTTAACGTACTG
TRN  10010101100011001
NAM  BM3R_BACME/11-57
ASQ  IFSASLLLFA.ERGFDATTMPMIAENAKVGAGTIYRYFK.NKESLVNEL
DSQ  ATTTTTTCTGCTTCGCTTCTGCTGTTTGCA...GAAAGAGGGTTTGATGCAACCACGATGCCAATGATTGCAGAGAATGCCAAAGTAGGAGCAGGAACAATTTATCGCTACTTTAAA...AATAAAGAAAGCCTTGTAAATGAATTA
TRN  10010101100011010
NAM  Q59306_CLOPA/8-54
ASQ  IFYSAIKVFS.NNGYNGATMDEIASNAGVAKGTLYYHFK.SKEEIFKYI
DSQ  ATTTTTTACTCTGCAATTAAAGTTTTTTCC...AATAATGGATATAATGGAGCTACTATGGATGAAATAGCTAGTAATGCAGGTGTTGCCAAGGGAACTTTATATTATCATTTTAAA...AGTAAAGAAGAGATATTTAAATATATA
TRN  10010101110011010
NAM  YHGD_BACSU/9-55
ASQ  ILEAATKSFT.QFGYKATTMDLVAKLANVGKGTIYTFFK.NKEELFDEI
DSQ  ATTTTGGAGGCGGCTACAAAGTCTTTCACG...CAGTTCGGGTATAAAGCGACGACAATGGATCTTGTCGCAAAACTTGCGAACGTGGGGAAGGGAACCATTTATACTTTTTTCAAA...AACAAAGAAGAGCTGTTTGACGAGATT
TRN  11011101101011011
NAM  O27135_METTH/17-63
ASQ  IIRAAEKAFF.ARGYDRVTMDEIAEEAEVNKALLYYYFK.NKESLFFAV
DSQ  ATAATAAGGGCGGCAGAGAAGGCATTCTTT...GCACGGGGATACGACAGAGTGACCATGGATGAGATAGCCGAGGAGGCAGAGGTCAACAAGGCCCTCCTCTACTACTACTTCAAA...AACAAGGAATCCCTCTTCTTCGCAGTG
TRN  10010101110011011
NAM  O34643_BACSU/8-54
ASQ  ILDAAMQLLV.KKGYRATTTKEIAEKANVSEATIFRNFK.NKQGLVEAL
DSQ  ATCCTTGATGCTGCCATGCAGCTGCTCGTC...AAAAAAGGATATCGCGCAACGACTACAAAAGAAATTGCAGAAAAAGCAAATGTAAGTGAAGCGACGATTTTCAGGAACTTTAAA...AACAAACAAGGACTAGTTGAGGCTTTG
TRN  10010101100011011
NAM  O27815_METTH/18-64
ASQ  ITNAARELFI.KRGYRGTATREIASRAGVSEVTVFRKFG.SKKNLLKRI
DSQ  ATAACCAATGCTGCAAGGGAACTCTTCATA...AAGAGGGGGTACAGAGGTACAGCTACCCGTGAAATCGCATCGCGGGCCGGTGTGAGTGAAGTAACAGTATTCAGAAAATTTGGA...TCCAAGAAAAATCTTCTCAAAAGGATA
TRN  10010101110011011
NAM  P73186_SYNY3/47-93
ASQ  ILKGALKLFG.TKGYEGTTTKDLAQAANVAEGTLFRYFT.NKKAILVEV
DSQ  ATTTTGAAGGGAGCTTTGAAATTATTTGGC...ACTAAGGGTTACGAAGGTACTACCACAAAGGATTTGGCCCAGGCAGCCAACGTGGCCGAAGGAACGCTATTCCGTTATTTCACC...AATAAGAAGGCCATTTTGGTGGAAGTG
TRN  11011101111011010
NAM  Q59213_BACME/8-54
ASQ  ILGHTHQLFM.EKGYVDTSVQDILERSGISKGTFYKYFS.SKSELLISL
DSQ  ATTTTAGGGCATACGCACCAGCTTTTTATG...GAAAAAGGATACGTAGACACTTCGGTACAAGATATATTAGAAAGAAGCGGGATTTCAAAAGGAACATTTTATAAATATTTCTCA...TCTAAAAGCGAACTGCTTATCTCATTA
TRN  10010101100011000
NAM  O53054_LISIV/8-54
ASQ  IIKSAKEVFQ.KQGYLKTSVQDIVDAAEISKGTFYNYFT.SKEELAIVI
DSQ  ATTATTAAGTCAGCTAAAGAAGTGTTTCAA...AAACAAGGTTATTTAAAAACATCAGTGCAGGATATAGTAGATGCTGCTGAGATTTCTAAAGGGACTTTCTATAATTATTTTACT...TCTAAAGAGGAACTGGCAATTGTGATT
TRN  10010101100011000
NAM  O67157_AQUAE/7-53
ASQ  ILEVSKELFF.EKGYQGTSVEEIVKRANLSKGAFYFHFK.SKEELITEI
DSQ  ATTCTGGAAGTTTCAAAGGAATTGTTCTTT...GAAAAGGGATATCAGGGAACGAGTGTTGAGGAGATCGTAAAGAGGGCGAACCTTTCAAAGGGAGCCTTTTACTTCCACTTCAAA...AGTAAGGAAGAATTAATAACCGAAATA
TRN  10010101100011000
NAM  QACR_STAAM/7-53
ASQ  ILGVAKELFI.KNGYNATTTGEIVKLSESSKGNLYYHFK.TKENLFLEI
DSQ  ATACTAGGTGTCGCAAAGGAATTATTTATA...AAAAATGGATATAATGCCACTACTACTGGAGAAATTGTTAAATTATCAGAAAGTAGTAAAGGGAATCTTTATTATCACTTTAAA...ACAAAAGAAAATCTATTTTTAGAAATT
TRN  10010101110011000
NAM  O66658_AQUAE/15-61
ASQ  IMRVACKLFA.QKGYHNTTMPDIAKALGMSVGNLYNYFS.SKEELAKEI
DSQ  ATAATGAGGGTAGCCTGTAAACTCTTTGCC...CAGAAAGGCTATCACAACACCACTATGCCAGATATAGCTAAAGCATTAGGTATGAGTGTTGGAAACCTCTACAACTACTTCTCC...TCAAAAGAAGAACTGGCAAAGGAGATA
TRN  10010101100011000
NAM  P94423_BACSU/8-54
ASQ  ILLAARKLFS.EKDFTSVSMQAIAEECKMSKASIYKLFQ.SKEDLLLEL
DSQ  ATCTTGTTAGCCGCGCGAAAGCTTTTTTCG...GAAAAGGATTTTACGTCGGTTTCCATGCAGGCGATCGCAGAAGAATGTAAGATGTCAAAAGCTTCGATATATAAGCTGTTCCAA...TCTAAAGAAGATCTGCTTTTGGAGCTG
TRN  10010101100011000
NAM  O67927_AQUAE/18-64
ASQ  ILSSALKLFS.KKGFKETTIKDIAKEVGITEGAIYRHFT.SKEEIIKSL
DSQ  ATACTGAGTTCCGCACTCAAACTCTTTTCC...AAAAAGGGATTTAAGGAAACCACCATAAAAGACATAGCAAAGGAGGTAGGCATAACCGAGGGTGCTATATACAGGCACTTCACG...AGCAAGGAAGAAATAATAAAGAGCCTT
TRN  10010101100011011
NAM  YERO_BACSU/8-54
ASQ  IIKTSIRLFA.KKGFAATTIQEIASECGISKGAFYLHFK.SKEALLLSA
DSQ  ATCATAAAAACCAGCATTCGTTTATTTGCG...AAAAAAGGATTCGCAGCTACGACGATCCAAGAAATCGCCAGTGAATGCGGCATTTCGAAGGGCGCTTTTTATTTGCACTTCAAA...TCGAAAGAAGCGCTGCTGTTATCTGCC
TRN  10010101100011010
NAM  YUXN_BACSU/8-54
ASQ  IIETALKLFA.QKGYNSTSVQEIAKECKISKGAFYIYFP.SKEALLLSM
DSQ  ATTATTGAAACAGCCTTAAAACTATTTGCC...CAAAAAGGATACAACTCAACATCAGTCCAGGAAATCGCAAAAGAATGCAAAATATCTAAAGGCGCTTTTTATATTTATTTTCCT...TCGAAAGAAGCGCTTCTTCTCTCTATG
TRN  10010101110011000
NAM  O34619_BACSU/10-57
ASQ  ILSAATRLFQ.LQGYYGTGLNQIIKESGAPKGSLYYHFPgGKEQLAIEA
DSQ  ATCCTTTCGGCAGCTACCCGGCTTTTTCAG...CTGCAAGGGTATTACGGCACGGGGCTGAACCAGATTATAAAGGAAAGCGGCGCGCCTAAAGGCTCTCTTTACTACCACTTTCCCgggGGTAAAGAACAGCTTGCGATCGAAGCC
TRN  10010101100011011
NAM  YXAF_BACSU/11-58
ASQ  ILHTASRLSQ.LQGYHATGLNQIVKESGAPKGSLYHFFPnGKEELAIEA
DSQ  ATCCTTCACACGGCGTCACGTCTGTCCCAG...CTGCAAGGATATCACGCGACAGGTTTGAACCAGATTGTAAAAGAAAGCGGTGCTCCAAAAGGATCGCTTTATCACTTTTTTCCGaatGGCAAAGAAGAACTAGCAATTGAAGCG
TRN  11011101101011001
NAM  O85706_CLOAB/14-60
ASQ  LIECAAKLFL.QKGYNGTGINDILSGTGLPKGSFYFHFA.SKKDLAISV
DSQ  CTAATAGAATGTGCTGCGAAATTATTTTTA...CAAAAAGGATATAATGGTACAGGTATTAATGATATTCTATCAGGGACAGGGTTGCCAAAGGGGTCATTTTACTTTCACTTTGCA...AGTAAAAAAGATTTAGCCATTAGTGTT
TRN  10010101110011000
NAM  YPB3_LACLA/13-59
ASQ  ILTATEQLIY.KKGYTGTSINDILDETATGKGQFYYYFD.SKKEACLAV
DSQ  ATATTGACGGCTACAGAACAGCTTATATAT...AAAAAAGGTTATACAGGGACTTCTATTAATGATATTTTAGATGAAACTGCGACAGGCAAAGGGCAATTCTATTATTACTTTGAT...TCAAAAAAAGAAGCTTGCCTAGCAGTC
TRN  10010101110011000
NAM  Q9ZN97_ECOLI/22-68
ASQ  LLKVAYRFFV.DKGFKNTSLEDITSSVGIAKSSFYIFFE.SKEILYMEL
DSQ  TTGCTTAAAGTTGCATATCGATTTTTTGTA...GATAAAGGCTTTAAGAATACTTCTCTCGAGGATATTACTTCATCAGTTGGCATTGCAAAGAGTTCTTTTTATATATTTTTTGAA...TCAAAAGAAATACTATATATGGAATTG
TRN  10010101110011001
NAM  Q9Z601_NOSPU/12-57
ASQ  ILEAARQVFL.QQGFGAS-TLEIAQQAGISEASIFKRFS.TKEELFFAA
DSQ  ATATTAGAAGCGGCTCGTCAAGTTTTCCTG...CAACAAGGATTTGGTGCTTCA---ACCTTAGAAATTGCTCAACAGGCAGGTATTTCTGAAGCTTCAATTTTCAAGCGATTCTCA...ACCAAAGAAGAATTATTTTTTGCGGCG
TRN  10010101100011000
NAM  Q9Z3X8_9PSED/7-53
ASQ  ILECALQLFN.QKGEPNVSTMEVANEMGISPGNLYYHFH.GKEPLILGL
DSQ  ATCCTCGAATGTGCCCTGCAACTGTTCAAC...CAAAAGGGCGAACCGAATGTCTCCACCATGGAAGTTGCCAATGAGATGGGCATCAGCCCTGGCAACCTCTATTACCACTTTCAT...GGCAAGGAACCGCTGATCCTCGGCTTG
TRN  11011111101111111
NAM  Q51516_PSEAE/7-53
ASQ  ILECSLLLFN.EQGEPNVSTLEIANELGISPGNLYYHFH.GKEPLVMAL
DSQ  ATCCTCGAATGCTCGCTGTTGCTGTTCAAC...GAACAGGGCGAGCCCAACGTCTCGACACTGGAGATCGCCAACGAACTGGGCATCAGCCCGGGCAATCTCTACTACCACTTCCAT...GGCAAGGAACCGCTGGTGATGGCGCTG
TRN  11011111101111111
NAM  Q9ZGB7_STRCY/16-62
ASQ  IQSVALELFI.ERGYEKTSMREIAEGLGITKAALYYHFK.AKEEILVAI
DSQ  ATCCAGTCCGTCGCCCTCGAGCTCTTCATC...GAGCGCGGCTACGAGAAGACATCGATGCGCGAGATCGCCGAAGGGCTCGGCATCACCAAGGCGGCGCTCTACTACCACTTCAAG...GCCAAGGAAGAGATCCTCGTGGCGATC
TRN  11011111111111111
NAM  O08306_NOCSI/21-64
ASQ  ILAAATRLFA.THGVSGTSLQQIADAAGITKAAVYHHFP.TKEEVV---
DSQ  ATCCTCGCCGCCGCGACCCGGCTCTTCGCC...ACGCACGGCGTCTCCGGCACCTCGCTGCAGCAGATCGCGGACGCCGCCGGGATCACCAAGGCCGCCGTCTACCACCACTTCCCC...ACCAAGGAGGAGGTCGTC---------
TRN  11011111101111111
NAM  O53310_MYCTU/15-61
ASQ  ILGAAAELIA.LRGYSSTSTRDIAAAVGVEQPAIYKHFS.AKRDILAAL
DSQ  ATCCTGGGGGCCGCTGCCGAGCTCATCGCG...CTGCGGGGTTACAGCTCCACCTCGACGCGAGACATTGCCGCAGCCGTCGGGGTGGAGCAGCCGGCCATCTACAAACACTTCTCG...GCCAAACGCGATATCCTTGCGGCCCTG
TRN  11011101101011011
NAM  P95251_MYCTU/19-65
ASQ  ILDQAVGLFI.ERGFHSVKLEDIAEAAGVTARALYRHYD.NKQALLAEA
DSQ  ATTTTGGATCAGGCCGTTGGACTGTTCATC...GAACGTGGCTTCCATTCGGTCAAATTGGAGGACATTGCCGAGGCGGCCGGGGTGACCGCGCGCGCGTTGTATCGCCACTACGAC...AACAAGCAGGCGTTGCTCGCCGAAGCG
TRN  11011101101011011
NAM  O06169_MYCTU/30-76
ASQ  LLAAAERLFA.ERGFLAVRLEDIGAAAGVSGPAIYRHFP.NKESLLVEL
DSQ  CTCTTGGCAGCCGCCGAACGATTGTTTGCC...GAACGAGGATTCCTGGCGGTGCGACTGGAGGACATCGGCGCCGCCGCGGGCGTCAGCGGTCCGGCCATCTACCGACACTTCCCC...AACAAAGAGTCGCTGCTGGTGGAATTG
TRN  11011101101011011
NAM  O68442_9RHIZ/15-61
ASQ  ILQAAETLFL.DKGYDNVSLEEIAALSGVTRGAIHWHFK.NKHGLLLAL
DSQ  ATCTTGCAGGCGGCGGAGACCCTGTTTCTG...GACAAGGGCTACGACAATGTGAGCCTGGAAGAAATCGCTGCTCTTTCCGGCGTGACCCGCGGGGCGATCCACTGGCACTTCAAG...AACAAGCACGGGCTTCTGCTCGCGCTC
TRN  11011111101111111
NAM  MTRR_NEIGO/15-61
ASQ  LMLAALETFY.RKGIARTSLNEIAQAAGVTRGALYWHFK.NKEDLFDAL
DSQ  CTGATGCTTGCCGCCTTGGAAACCTTTTAC...CGCAAAGGGATTGCCCGCACCTCGCTCAACGAAATCGCCCAAGCCGCCGGCGTAACGCGCGGCGCGCTCTATTGGCATTTCAAA...AATAAGGAAGACTTGTTTGACGCGTTG
TRN  11011101101011011
NAM  ACRR_ECOLI/16-62
ASQ  ILDVALRLFS.QQGVSSTSLGEIAKAAGVTRGAIYWHFK.DKSDLFSEI
DSQ  ATCCTCGATGTGGCTCTACGTCTTTTCTCA...CAGCAGGGGGTATCATCCACCTCGCTGGGCGAGATTGCAAAAGCAGCTGGCGTTACGCGCGGTGCAATCTACTGGCATTTTAAA...GACAAGTCGGATTTGTTCAGTGAGATC
TRN  11011101101011001
NAM  ENVR_ECOLI/16-62
ASQ  LIETAIAQFA.QHGVSKTTLNDIADAANVTRGAIYWHFE.NKTQLFNEM
DSQ  CTGATTGAAACTGCCATCGCCCAGTTTGCG...CAGCATGGCGTAAGCAAGACGACGCTCAACGACATTGCCGACGCCGCTAACGTTACGCGTGGCGCTATCTACTGGCACTTCGAA...AACAAGACTCAACTGTTTAATGAGATG
TRN  11011111101111111
NAM  Q9ZHP8_STRFR/13-59
ASQ  TIVAAAAVFD.ELGYEATTIAEILKRSGVTKGALYFHFT.SKEQLAQEV
DSQ  ACGATCGTCGCGGCCGCCGCCGTGTTCGAC...GAACTGGGCTACGAGGCGACCACCATCGCGGAGATCCTCAAGAGGTCCGGGGTGACCAAGGGAGCGCTGTACTTCCACTTCACG...TCCAAGGAGCAGCTCGCGCAGGAAGTG
TRN  10010101100011011
NAM  O86852_STRCO/14-60
ASQ  ILDAAAQVFE.KQGYQAATITEILKVAGVTKGALYFHFQ.SKEELALGV
DSQ  ATCCTGGACGCCGCGGCGCAGGTCTTCGAG...AAGCAGGGCTACCAAGCTGCCACGATCACGGAGATCCTCAAGGTGGCCGGGGTGACCAAGGGAGCCCTCTACTTCCACTTCCAG...TCCAAGGAAGAACTGGCGCTGGGCGTC
TRN  11011111101111111
NAM  O66121_STRCO/14-60
ASQ  IVRAAADLFD.RHGYESTSLSEIVAHAGVTKGALYFHFA.AKEDLAHAI
DSQ  ATTGTCCGTGCGGCGGCCGACCTGTTCGAC...CGCCACGGCTACGAGTCGACCAGTCTGAGCGAGATCGTCGCCCACGCCGGGGTCACCAAGGGCGCCCTGTACTTCCACTTCGCG...GCGAAGGAAGACCTCGCGCACGCCATC
TRN  11011111101111111
NAM  AFRP_STRGR/14-60
ASQ  IVDAAASVFD.DYGYERAAISEILRRAKVTKGALYFHFA.SKEAIAQAI
DSQ  ATCGTGGATGCCGCGGCGAGTGTCTTCGAC...GACTACGGCTACGAGCGTGCCGCCATCTCGGAGATTCTGCGCCGCGCCAAGGTCACCAAGGGGGCCTTGTACTTCCACTTCGCC...TCCAAGGAGGCCATCGCCCAGGCGATC
TRN  11011111101111111
NAM  O24739_STRVG/15-61
ASQ  LVLSAAEAFD.RQGFATASLTAISNSAGVSNGALHFHFE.SKEALAAAV
DSQ  CTGGTGCTCTCGGCGGCCGAGGCCTTCGAT...CGGCAGGGTTTCGCGACGGCCTCGCTCACCGCCATCAGCAACAGCGCCGGTGTCAGTAACGGGGCCCTGCACTTCCACTTCGAG...AGCAAGGAAGCGCTCGCCGCCGCCGTC
TRN  11011111101111111
NAM  TETC_ECOLI/18-64
ASQ  LVNSARILFV.EKGYQAVSIDEISGKALVTKGAFYHHFK.NKKQLLSAC
DSQ  CTGGTTAACTCAGCACGAATATTGTTTGTT...GAAAAAGGCTATCAAGCTGTTTCAATAGATGAGATCTCGGGAAAAGCGTTGGTGACCAAAGGTGCCTTTTATCATCACTTTAAA...AATAAAAAACAATTACTCAGTGCCTGT
TRN  10010101100011000
NAM  O05858_MYCTU/44-90
ASQ  LLVVASDVFV.DRGYHAAGMDEIADRAGVSKPVLYQHFS.SKLELYLAV
DSQ  TTGCTTGTCGTTGCCAGTGACGTCTTCGTC...GATCGGGGTTACCACGCGGCCGGTATGGACGAGATCGCGGATCGGGCGGGAGTCAGTAAACCCGTTCTGTATCAACATTTTTCG...AGCAAGTTAGAACTTTACCTGGCTGTG
TRN  11011101101011010
NAM  O53612_MYCTU/19-64
ASQ  VLEVAYQTFA.ADGLS-VPVDEIARRAGVGAGTVYRHFP.TKEALFQAV
DSQ  GTATTGGAGGTTGCCTACCAAACCTTTGCG...GCCGACGGTCTATCG---GTGCCCGTTGACGAGATCGCTCGGCGCGCCGGAGTCGGCGCAGGCACGGTATACCGGCATTTCCCG...ACCAAGGAGGCGCTGTTTCAGGCGGTG
TRN  11011111101111111
NAM  P94548_BACSU/11-57
ASQ  IIDAAVEVIA.ENGYHQSQVSKIAKQAGVADGTIYLYFK.NKEDILISL
DSQ  ATTATTGATGCAGCAGTAGAAGTCATTGCA...GAAAACGGCTACCACCAGTCACAGGTATCCAAAATTGCCAAACAAGCCGGGGTAGCGGACGGCACCATCTATCTCTATTTTAAA...AACAAAGAAGATATTTTAATTTCTCTT
TRN  11011101111011000
NAM  O08377_MYCTU/24-70
ASQ  ILAAAKIVFA.HKGFHATTVADIAKQAGLAYGLIYWYFD.SKDDLFHAL
DSQ  ATCTTGGCCGCGGCCAAAATAGTGTTTGCT...CACAAGGGTTTTCATGCCACCACCGTCGCAGACATCGCCAAGCAGGCCGGCCTGGCGTACGGGCTGATCTACTGGTACTTCGAC...TCCAAGGACGACTTGTTCCACGCCTTG
TRN  10010101100011011
NAM  P96701_BACSU/12-58
ASQ  LLKAAANEFS.VRGFHDAKVSEIVKKAGFTQPSFYLYFQ.SKEAIFAEL
DSQ  TTACTTAAAGCTGCCGCTAATGAATTTTCG...GTTCGGGGATTCCATGACGCGAAGGTAAGTGAAATTGTGAAAAAAGCTGGGTTCACGCAGCCTTCATTTTACCTGTACTTTCAA...AGCAAAGAAGCCATCTTTGCCGAGTTA
TRN  11011101101011000
NAM  O66635_AQUAE/12-58
ASQ  IIKAAAKEFA.EKGFYNTQISHIVESAGVARGTFYIYFK.SKEEVFEEI
DSQ  ATAATAAAAGCAGCTGCAAAGGAGTTTGCG...GAAAAGGGGTTTTATAATACCCAGATTTCTCACATAGTGGAAAGTGCGGGAGTTGCGAGGGGAACTTTTTACATATACTTCAAG...AGCAAGGAAGAAGTCTTTGAAGAGATA
TRN  10010101110011011
NAM  O07001_BACSU/12-58
ASQ  ILQAAIEVIS.EKGLDKASISDIVKKAGTAQGTFYLYFS.SKNALIPAI
DSQ  ATATTGCAGGCGGCCATAGAAGTCATTTCT...GAAAAAGGCCTCGACAAAGCTTCTATTTCTGATATTGTCAAAAAGGCCGGCACTGCCCAAGGAACATTCTATTTGTATTTTTCA...TCTAAAAATGCCCTCATACCGGCCATT
TRN  10010101110011001
NAM  UIDR_ECOLI/16-62
ASQ  ILNAAREIFS.ENGFHSASMKAICKSCAISPGTLYHHFI.SKEALIQAI
DSQ  ATCCTCAATGCTGCCAGAGAGATTTTTTCA...GAAAATGGATTTCACAGTGCCTCGATGAAAGCCATCTGTAAATCTTGCGCCATTAGTCCCGGGACGCTCTATCACCATTTCATC...TCCAAAGAAGCCTTGATTCAGGCGATT
TRN  10010101110011001
NAM  O31560_BACSU/17-63
ASQ  ILEAAKTVFK.RKGFELTTMKDVVEESGFSRGGVYLYFS.STEEMFRRI
DSQ  ATTTTAGAGGCTGCCAAAACGGTTTTTAAA...CGAAAAGGATTCGAATTAACGACGATGAAGGATGTTGTAGAAGAGTCAGGTTTCAGCCGGGGCGGTGTCTATCTTTATTTTTCA...AGCACTGAGGAGATGTTTCGCCGCATT
TRN  11011101111011000
NAM  O69500_MYCLE/17-63
ASQ  MLDAAVQMFS.VNGYHKTSMDAIAAEAQISKPMLYLYYG.SKEDLFGAC
DSQ  ATGTTGGACGCCGCGGTGCAGATGTTCTCG...GTCAACGGTTACCACAAGACCTCGATGGACGCCATCGCCGCTGAGGCGCAGATTTCCAAGCCAATGCTGTATCTGTATTACGGC...TCCAAGGAAGACCTCTTCGGCGCCTGC
TRN  11011111101111111
NAM  O53323_MYCTU/22-68
ASQ  ILKAAAELFY.CEGINATGVELIANKASVSKRTLYQHFP.SKSALVEEY
DSQ  ATCTTGAAGGCGGCTGCAGAGCTGTTCTAC...TGCGAGGGCATCAACGCCACCGGGGTCGAACTGATTGCGAACAAGGCTTCGGTATCCAAGCGGACTCTCTACCAACACTTTCCG...AGTAAGTCCGCGTTGGTGGAGGAGTAC
TRN  11011111101111111
NAM  O86514_STRCO/19-65
ASQ  VLAAAERLFY.EHGIHAVGVDTIAAEAGVTKKTLYDRFG.SKEQIVVEY
DSQ  GTGCTGGCAGCCGCCGAGCGGCTGTTCTAC...GAGCACGGCATCCACGCCGTCGGCGTGGACACCATCGCCGCCGAGGCGGGGGTGACCAAGAAGACGCTGTACGACCGCTTCGGT...TCGAAGGAGCAGATCGTCGTCGAGTAC
TRN  11011111101111111
NAM  P96839_MYCTU/15-61
ASQ  LLELAAAMFA.ERGLRATTVRDIADGAGILSGSLYHHFA.SKEEMVDEL
DSQ  TTGCTGGAGCTCGCGGCGGCGATGTTCGCC...GAGCGCGGACTGCGCGCCACCACCGTGCGCGATATCGCCGACGGCGCCGGCATCCTATCCGGCAGCCTGTATCACCATTTCGCC...TCCAAAGAGGAGATGGTCGATGAGCTG
TRN  11011101101011011
NAM  P96812_MYCTU/20-66
ASQ  LLDGLVASIG.ERGYRATTVSDIVRHARTSKRTFYDRFT.SKEQCFLEL
DSQ  TTGCTCGACGGCCTGGTCGCCTCGATCGGT...GAGCGGGGTTATCGCGCCACCACCGTCTCCGACATCGTCCGGCACGCCCGCACATCCAAGCGCACGTTCTACGACCGGTTCACC...AGCAAGGAACAGTGCTTTTTGGAACTC
TRN  11011111101111111
NAM  P95251_MYCTU/223-269
ASQ  LLAAGARLFR.AQGYPAVNTSEIGKGAGIAGPGLYRSFS.SKQAILDAL
DSQ  CTGCTGGCCGCGGGCGCGCGGCTGTTCCGT...GCGCAGGGCTATCCGGCCGTCAACACCAGCGAAATCGGCAAGGGAGCCGGCATCGCGGGCCCGGGGCTGTACCGTTCGTTTTCT...TCCAAACAGGCCATCCTGGACGCGCTC
TRN  11011101101011011
NAM  O07229_MYCTU/19-65
ASQ  ILDATERLMA.TKGYAATSISDIRDACGLAPSSIYWHFG.SKEGVLAAM
DSQ  ATTCTCGACGCGACCGAACGCCTGATGGCG...ACCAAGGGCTACGCGGCGACCTCGATCAGCGACATCCGCGACGCGTGCGGGCTAGCACCCAGCTCTATTTACTGGCACTTCGGC...TCCAAAGAGGGCGTGCTGGCCGCCATG
TRN  11011101101011011
NAM  YJGJ_ECOLI/21-67
ASQ  AISAAKVLFH.QKGFDAVSVAEVTDYLGINPPSLYAAFG.SKAGLFSRV
NAM  YCFQ_ECOLI/24-70
ASQ  ALDKAMKLFW.QHGYEATSLADLVEATGAKAPTLYAEFT.NKEGLFRAV
NAM  P96821_MYCTU/93-139
ASQ  ILHAARQVFS.ERGYDGATFQEIAVRADLTRPAINHYFA.NKRVLYQEV
DSQ  ATTCTGCACGCCGCCCGTCAAGTGTTCAGC...GAACGTGGTTATGACGGCGCGACTTTTCAGGAGATCGCCGTCCGCGCCGACCTGACCCGACCGGCGATCAACCACTACTTCGCC...AACAAGCGGGTGCTCTACCAAGAGGTG
TRN  11011111101111111
NAM  O53119_MYCLE/19-65
ASQ  LTLARHRLWR.LRGYAEVGTPEIAKEADTTRGAVYHQFT.DKAALFRDV
DSQ  CTGACTTTAGCTCGGCACAGGCTGTGGAGA...CTACGGGGTTACGCGGAAGTGGGCACGCCCGAGATAGCCAAAGAAGCGGACACCACCCGAGGAGCGGTCTACCACCAATTTACC...GACAAGGCCGCACTATTCCGCGATGTC
TRN  10010101100011010
NAM  O53623_MYCTU/19-65
ASQ  LITGARKLWG.LRGYAEVGTPEIATEAGVTRGAMYHQFA.DKAALFRDV
DSQ  CTGATCACCGGGGCCCGCAAGCTGTGGGGG...TTACGGGGTTATGCGGAGGTGGGGACGCCGGAAATCGCGACCGAGGCGGGGGTCACGCGGGGGGCGATGTACCACCAATTCGCC...GATAAAGCAGCACTATTCCGCGATGTG
TRN  11011101101011010
NAM  P72624_SYNY3/24-70
ASQ  ILDRARHLFA.TKGYAATGTEEIISELAITRGALYHQFG.DKRGLFKAV
DSQ  ATCCTTGACCGGGCCCGTCACCTGTTTGCC...ACCAAGGGGTACGCCGCCACTGGCACCGAAGAAATTATCAGTGAGCTAGCCATTACCAGGGGAGCTTTATATCATCAATTCGGG...GACAAGCGGGGGCTGTTTAAAGCTGTC
TRN  10010101100011010
NAM  O07252_MYCTU/11-57
ASQ  LLDGALACLR.ERGYGNTSSRDIARAAGVNIASINYHFG.SKDALLDDA
DSQ  CTGCTCGACGGCGCTCTGGCTTGTTTACGA...GAACGCGGCTACGGCAACACCAGCTCGCGCGACATCGCTCGTGCGGCAGGGGTGAACATCGCGTCGATCAACTACCACTTCGGT...AGCAAGGACGCGCTGCTCGACGATGCG
TRN  11011111101111110
NAM  YBIH_ECOLI/17-62
ASQ  LIAAALAQFG.EYGMNAT-TREIAAQAGQNIAAITYYFG.SKEDLYLAC
DSQ  CTGATTGCTGCCGCACTGGCGCAGTTTGGT...GAATATGGAATGAACGCCACC---ACTCGCGAGATAGCCGCCCAGGCCGGGCAGAATATCGCTGCCATCACCTACTACTTCGGT...TCGAAAGAAGATTTGTACCTCGCCTGC
TRN  10010101100011011
NAM  BETI_RHIME/14-60
ASQ  LVDAALRVIG.DQGTLAVTMSEIARTAGVSPALAHHYFG.SKEQLLIAT
DSQ  CTGGTCGATGCGGCGCTGCGCGTGATCGGC...GATCAGGGTACGCTCGCGGTGACCATGTCGGAGATCGCGCGGACGGCCGGCGTCTCACCCGCGCTCGCGCATCACTATTTCGGC...AGCAAGGAGCAGTTGCTGATCGCCACG
TRN  11011111101111101
NAM  BETI_ECOLI/14-60
ASQ  LIDATLEAIN.EVGMHDATIAQIARRAGVSTGIISHYFR.DKNGLLEAT
DSQ  CTGATCGACGCCACACTGGAAGCAATAAAT...GAAGTGGGCATGCACGATGCAACGATCGCGCAGATCGCCCGCCGTGCAGGCGTTTCTACGGGGATCATCAGCCACTATTTCAGG...GACAAAAATGGTCTGCTGGAAGCAACC
TRN  10010101100011011
NAM  O33453_PSEPU/19-65
ASQ  LIAAALGVLR.EKGYAGFRIADVPGAAGVSRGAQSHHFP.TKLELLLAT
DSQ  TTGATTGCAGCGGCCCTGGGGGTTTTACGG...GAAAAAGGTTACGCGGGATTCCGGATCGCAGATGTGCCCGGTGCTGCAGGTGTCTCGAGAGGAGCGCAGAGCCATCATTTCCCG...ACAAAGCTTGAGCTTCTGCTTGCCACT
TRN  10010101100011010
NAM  O28458_ARCFU/8-54
ASQ  IIEAALRLYM.KKPPHEVSIEEIAREAKVSKSLIFYHFE.SKQKLLEEA
DSQ  ATAATCGAAGCTGCCCTAAGGCTTTACATG...AAAAAGCCGCCGCACGAAGTGAGCATTGAGGAGATAGCGAGAGAGGCAAAGGTGTCGAAGAGCCTCATCTTTTACCACTTCGAA...AGCAAGCAGAAGCTTCTTGAGGAGGCT
TRN  10010101110011011
NAM  O86312_MYCTU/12-57
ASQ  IREAAIEQFG.RHGFGVG-LRAIAEAAGVSAALVIHHFG.SKEGLRKAC
DSQ  ATCAGAGAGGCGGCCATCGAACAGTTCGGT...CGGCACGGATTCGGTGTCGGG---CTGCGAGCCATCGCCGAAGCGGCGGGGGTGAGCGCGGCATTGGTCATCCACCATTTCGGT...TCCAAGGAAGGTCTGCGCAAGGCCTGC
TRN  10010101100011011
NAM  LUXR_VIBHA/21-67
ASQ  LMEIALEVFA.RRGIGRGGHADIAEIAQVSVATVFNYFP.TREDLVDEV
DSQ  CTGATGGAAATCGCTCTTGAAGTGTTTGCT...CGTCGCGGCATTGGCCGTGGTGGTCACGCGGATATTGCAGAGATCGCTCAAGTTTCTGTTGCGACGGTATTTAACTACTTCCCT...ACTCGTGAAGATTTGGTGGATGAAGTT
TRN  11011111101111111
NAM  O33187_MYCTU/24-70
ASQ  ILSSARELFA.HNGIDRTSIRAVAAKAGVDAALVHHYFG.TKQQLFAAA
DSQ  ATCCTGTCCAGTGCCCGAGAACTCTTTGCG...CACAACGGCATTGACAGAACATCGATCCGAGCCGTGGCCGCCAAGGCCGGTGTTGATGCCGCACTAGTGCATCACTACTTCGGC...ACCAAACAGCAGCTTTTCGCCGCCGCG
TRN  10010101100011011
NAM  Y3439_MYCBO/23-69
ASQ  ILQAATDLFA.ERGPAATSIRDIAARSKVNHGLVFRHFG.TKDQLVGAV
DSQ  ATCCTGCAGGCCGCCACCGACCTGTTCGCC...GAGCGTGGGCCAGCCGCGACGTCGATTCGCGACATCGCCGCTCGATCCAAGGTCAACCACGGGCTGGTGTTTCGTCACTTCGGC...ACCAAGGACCAACTGGTTGGGGCCGTG
TRN  11011111101111111
NAM  TCMR_STRGA/32-78
ASQ  LIREALELFL.AQGYEHTTVEQIAEAVEVHPRTFFRHFA.SKEEVALTP
NAM  Q53772_STAAU/14-60
ASQ  IIQYAFDSIV.EKGVKGSTVRQIAKLADMTPGQIRYYFP.NHSELLNAV
DSQ  ATCATTCAATACGCTTTCGACTCCATTGTA...GAAAAAGGAGTTAAGGGATCTACTGTAAGACAAATTGCGAAATTAGCTGATATGACACCTGGACAGATTAGATATTATTTTCCG...AATCATTCAGAGTTATTAAATGCTGTA
TRN  10110101110011000
NAM  YTTP_BACSU/9-55
ASQ  IIESAVMLFN.QKGFSGTSVREIAKSADVNVAHISYYFK.GKGGLMEHL
DSQ  ATTATTGAATCTGCTGTCATGCTTTTTAAC...CAAAAAGGATTTTCTGGCACGTCTGTCCGTGAAATCGCAAAGTCAGCTGATGTAAATGTTGCGCACATCTCCTACTATTTTAAA...GGCAAAGGAGGCTTGATGGAACACTTA
TRN  11011101111011000
NAM  Q55363_SYNY3/17-63
ASQ  LLTAANQVIV.SQGVDALTLDAVASEAGVSKGGLLHYFP.TKEALIAGM
DSQ  CTACTAACTGCGGCTAATCAAGTCATTGTT...AGTCAAGGGGTGGACGCCCTCACCTTGGATGCGGTGGCTAGTGAAGCAGGGGTGAGCAAAGGCGGATTGTTACACTACTTTCCC...ACCAAGGAGGCTTTAATTGCGGGCATG
TRN  11011101111011010
NAM  O86510_STRCO/15-61
ASQ  VLAAAMEMIA.ERGLEKLTMAALGREVGMSSGHLLYYFG.SKDELLLRT
DSQ  GTGCTCGCCGCCGCCATGGAGATGATCGCC...GAGCGCGGGCTGGAGAAGCTCACCATGGCGGCGCTCGGCCGCGAGGTCGGCATGAGCAGCGGCCACCTCTTGTATTACTTCGGC...TCCAAGGACGAACTGCTGCTGCGCACC
TRN  11011111101111111
NAM  PKSA_BACSU/14-57
ASQ  IAEATWRVIL.ERGMEGASARNIAKEAGLSLGALRHYFS.TQDELL---
DSQ  ATTGCAGAAGCAACGTGGCGCGTCATTTTA...GAACGAGGGATGGAGGGAGCATCAGCCAGAAATATTGCAAAGGAAGCAGGATTGTCATTAGGTGCGCTGCGCCATTATTTCTCT...ACACAGGATGAATTGCTT---------
TRN  10010101100011000
NAM  Y893_HAEIN/12-58
ASQ  IFSATDRLMA.REGLNQLSMLKLAKEANVAAGTIYLYFK.NKDELLEQF
DSQ  ATTTTTTCAGCGACAGATCGTTTAATGGCA...AGAGAAGGGTTGAATCAACTTTCTATGCTCAAACTTGCGAAAGAAGCAAATGTAGCCGCAGGAACGATTTACCTTTATTTTAAA...AACAAAGATGAATTGCTTGAACAATTT
TRN  10010101110011000
NAM  P96222_MYCTU/29-75
ASQ  ILATAENLLE.DRPLADISVDDLAKGAGISRPTFYFYFP.SKEAVLLTL
DSQ  ATCCTCGCCACCGCCGAGAACCTTCTCGAG...GACCGTCCGCTGGCCGATATCTCGGTCGACGATCTGGCCAAGGGCGCCGGTATCTCGAGGCCGACGTTCTACTTCTATTTCCCA...TCCAAGGAAGCGGTGCTGCTGACCCTG
TRN  10010101100011011
NAM  P95100_MYCTU/26-72
ASQ  ILRAARELLE.ETPFAELSVRAISLRAGVARSGFYFYFD.SKYSVLAQI
DSQ  ATTCTGCGGGCCGCACGCGAACTGCTGGAG...GAGACACCGTTCGCGGAATTGTCGGTGCGCGCTATCAGCCTTCGCGCAGGGGTAGCCCGCTCCGGTTTCTACTTCTACTTCGAT...TCCAAATACTCGGTGCTCGCCCAGATC
TRN  11011101101011011
NAM  YWCC_BACSU/17-63
ASQ  FIDAGVNLLI.DRAYDPVSVEDISRAAGYSKGAFYVHFV.SKDDFLLYL
DSQ  TTTATAGACGCTGGCGTGAATTTGTTGATT...GACCGAGCGTATGATCCGGTTTCTGTAGAAGATATCAGCAGAGCCGCCGGGTACAGCAAAGGAGCATTTTATGTTCATTTTGTC...AGCAAGGACGATTTTCTGCTGTACCTT
TRN  10010101100011011
NAM  O53295_MYCTU/35-80
ASQ  -IVDAAFRAI.DRLGPELSVRQIAEEAGTAKPKIYRHFT.DKSDLLEAI
DSQ  ---ATCGTCGACGCGGCGTTCCGCGCTATC...GACCGGCTGGGCCCCGAGCTGAGTGTGCGCCAAATCGCCGAAGAGGCCGGCACCGCCAAGCCCAAGATCTATCGGCATTTCACC...GACAAGTCCGATTTGCTCGAGGCTATC
TRN  11011111101111111
NAM  YIJC_ECOLI/15-62
ASQ  LVEAAFSQLSaERSFASLSLREVAREAGIAPTSFYRHFR.DVDELGLTM
NAM  O67930_AQUAE/8-54
ASQ  ILKVGAEVIA.HEGLRRFTAKNLASKIGISDAAIFKHFS.SMEEIAEEI
DSQ  ATTCTCAAAGTTGGTGCGGAAGTTATCGCC...CACGAAGGTTTAAGAAGGTTCACTGCAAAAAATCTGGCGAGTAAAATCGGAATAAGCGACGCGGCCATATTCAAACACTTTTCC...TCTATGGAAGAAATAGCGGAAGAAATC
TRN  10010101100011010
//