EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00415 - RCC1)
FAM  PF00415
PID  RCC1
DES  Regulator of chromosome condensation (RCC1)
IPR  IPR000408
ANO  7
ALN  68
AID  0.279672
APH  (RCC1_HUMAN/85-134:0.47563,((RCC1_HUMAN/190-255:1.04049,RCC1_HUMAN/312-360:0.74127):0.39189,RCC1_HUMAN/34-82:0.64819):0.08609,((RCC1_HUMAN/258-308:1.48968,RCC1_HUMAN/363-414:0.21615):0.64479,RCC1_HUMAN/137-187:0.57079):0.41578);
ATP  (RCC1_HUMAN/85-134,((RCC1_HUMAN/190-255,RCC1_HUMAN/312-360),RCC1_HUMAN/34-82),((RCC1_HUMAN/258-308,RCC1_HUMAN/363-414),RCC1_HUMAN/137-187));
ATL  6.72075
DNO  7
DLN  204
DID  0.415469
DPH  ((RCC1_HUMAN/85-134:0.36823,RCC1_HUMAN/137-187:0.35207):0.14837,((RCC1_HUMAN/312-360:0.60524,RCC1_HUMAN/34-82:0.39965):0.25255,RCC1_HUMAN/363-414:0.49081):0.05537,(RCC1_HUMAN/258-308:0.65397,RCC1_HUMAN/190-255:0.42678):0.29117);
DTP  ((RCC1_HUMAN/85-134,RCC1_HUMAN/137-187),((RCC1_HUMAN/312-360,RCC1_HUMAN/34-82),RCC1_HUMAN/363-414),(RCC1_HUMAN/258-308,RCC1_HUMAN/190-255));
DTL  4.04421
RID  0.279672
RPH  (RCC1_HUMAN/85-134:0.47563,((RCC1_HUMAN/190-255:1.04049,RCC1_HUMAN/312-360:0.74127):0.39189,RCC1_HUMAN/34-82:0.64819):0.08609,((RCC1_HUMAN/258-308:1.48968,RCC1_HUMAN/363-414:0.21615):0.64479,RCC1_HUMAN/137-187:0.57079):0.41578);
RTP  (RCC1_HUMAN/85-134,((RCC1_HUMAN/190-255,RCC1_HUMAN/312-360),RCC1_HUMAN/34-82),((RCC1_HUMAN/258-308,RCC1_HUMAN/363-414),RCC1_HUMAN/137-187));
RTL  6.72075
LNK  RCC1_HUMAN/137-187:P18754:X12654
LNK  RCC1_HUMAN/190-255:P18754:X12654
LNK  RCC1_HUMAN/258-308:P18754:X12654
LNK  RCC1_HUMAN/312-360:P18754:X12654
LNK  RCC1_HUMAN/34-82:P18754:X12654
LNK  RCC1_HUMAN/363-414:P18754:X12654
LNK  RCC1_HUMAN/85-134:P18754:X12654
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RCC1_HUMAN/363-414
ASQ  DGRVFAWGM--GTNYQLGTGQDEDAW-----------SPVEM---MGKQLENRVVLSVSSGGQHTVLL
DSQ  GATGGTCGTGTTTTCGCCTGGGGCATG------GGCACCAACTACCAGCTGGGCACAGGGCAGGATGAGGACGCCTGG---------------------------------AGCCCTGTGGAGATG---------ATGGGCAAACAGCTGGAGAACCGTGTGGTCTTATCTGTGTCCAGCGGGGGCCAGCATACAGTCTTATTA
TRN  11011101101011010
NAM  RCC1_HUMAN/137-187
ASQ  DGRVFLWGSFRDNNGVIGLLEPMKKSM----------VPVQV-------QLDVPVVKVASGNDHLVML
DSQ  GATGGCCGTGTCTTCCTCTGGGGCTCCTTCCGGGACAATAACGGTGTGATTGGACTGTTGGAGCCCATGAAGAAGAGCATG------------------------------GTGCCTGTGCAGGTG---------------------CAGCTGGATGTGCCTGTGGTAAAGGTGGCCTCAGGAAACGACCACTTGGTGATGCTG
TRN  11011111101111101
NAM  RCC1_HUMAN/85-134
ASQ  SGQVYSFGC--NDEGALGRDTSVEGSE---------MVPGKV-------ELQEKVVQVSAGDSHTAAL
DSQ  AGTGGCCAGGTCTATTCCTTCGGCTGC------AATGATGAGGGTGCCCTGGGAAGGGACACATCAGTGGAGGGCTCGGAG---------------------------ATGGTCCCTGGGAAAGTG---------------------GAGCTGCAAGAGAAGGTGGTACAGGTGTCAGCAGGAGACAGTCACACAGCAGCCCTC
TRN  10010101100011001
NAM  RCC1_HUMAN/34-82
ASQ  PGLVLTLGQ--GDVGQLGLGENVMERK----------KPALV-------SIPEDVVQAEAGGMHTVCL
DSQ  CCCGGCTTGGTGCTGACACTAGGCCAG------GGCGACGTGGGCCAGCTGGGGCTGGGTGAGAATGTGATGGAGAGGAAG------------------------------AAGCCGGCCCTGGTA---------------------TCCATTCCGGAGGATGTTGTGCAGGCTGAGGCTGGGGGCATGCACACCGTGTGTCTA
TRN  10010101100011011
NAM  RCC1_HUMAN/312-360
ASQ  EGKAYSLGR--AEYGRLGLGEGAEEKS----------IPTLI-------SRLPAVSSVACGASVGYAV
DSQ  GAAGGAAAAGCATACAGCCTGGGCCGG------GCTGAGTATGGGCGGCTGGGCCTTGGAGAGGGTGCTGAGGAGAAGAGC------------------------------ATACCCACCCTCATC---------------------TCCAGGCTGCCTGCTGTCTCCTCGGTGGCTTGTGGGGCCTCTGTGGGGTATGCTGTG
TRN  10010101100011011
NAM  RCC1_HUMAN/190-255
ASQ  DGDLYTLGC--GEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAI
DSQ  GATGGTGACCTCTACACCTTGGGCTGC------GGGGAACAGGGCCAGCTAGGCCGTGTGCCTGAGTTATTTGCCAACCGTGGTGGCCGGCAAGGCCTCGAACGACTCCTGGTCCCCAAGTGTGTGATGCTGAAATCCAGGGGAAGCCGGGGCCACGTGAGATTCCAGGATGCCTTTTGTGGTGCCTATTTCACCTTTGCCATC
TRN  10010101100011010
NAM  RCC1_HUMAN/258-308
ASQ  EGHVYGFGL--SNYHQLGTPGTESCF-----------IPQNL----TSFKNSTKSWVGFSGGQHHTVC
DSQ  GAGGGCCACGTGTACGGCTTCGGCCTC------TCCAACTACCATCAGCTTGGAACTCCGGGCACAGAATCTTGCTTC---------------------------------ATACCCCAGAACCTA------------ACATCCTTCAAGAATTCCACCAAGTCCTGGGTGGGCTTCTCTGGTGGCCAGCACCATACAGTCTGC
TRN  10010111110111011
//