EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00387 - PI-PLC-Y)
FAM  PF00387
PID  PI-PLC-Y
DES  Phosphatidylinositol-specific phospholipase C, Y domain
IPR  IPR001711
ANO  8
ALN  128
AID  0.4334
APH  ((((PIPA_DROME/549-666:0.25159,((PLCB1_BOVIN/539-656:0.15305,PLCB2_HUMAN/541-658:0.22393):0.08512,PIP1_DROME/598-715:0.22176):0.09252):0.23183,PLCD1_BOVIN/430-548:0.51857):0.16100,PIPA_DICDI/538-653:0.69602):0.56212,PLC1_SCHPO/637-753:0.34523,PLC1_YEAST/586-710:0.55750);
ATP  ((((PIPA_DROME/549-666,((PLCB1_BOVIN/539-656,PLCB2_HUMAN/541-658),PIP1_DROME/598-715)),PLCD1_BOVIN/430-548),PIPA_DICDI/538-653),PLC1_SCHPO/637-753,PLC1_YEAST/586-710);
ATL  4.13124
DNO  8
DLN  384
DID  0.494331
DPH  (((PLCD1_BOVIN/430-548:0.40178,((PLC1_SCHPO/637-753:0.40393,PLC1_YEAST/586-710:0.43776):0.17828,PIPA_DICDI/538-653:0.54182):0.25281):0.16653,PIPA_DROME/549-666:0.16039):0.11134,(PLCB1_BOVIN/539-656:0.20331,PLCB2_HUMAN/541-658:0.21089):0.12347,PIP1_DROME/598-715:0.21191);
DTP  (((PLCD1_BOVIN/430-548,((PLC1_SCHPO/637-753,PLC1_YEAST/586-710),PIPA_DICDI/538-653)),PIPA_DROME/549-666),(PLCB1_BOVIN/539-656,PLCB2_HUMAN/541-658),PIP1_DROME/598-715);
DTL  3.40422
RID  0.4334
RPH  ((((PIPA_DROME/549-666:0.25159,((PLCB1_BOVIN/539-656:0.15305,PLCB2_HUMAN/541-658:0.22393):0.08512,PIP1_DROME/598-715:0.22176):0.09252):0.23183,PLCD1_BOVIN/430-548:0.51857):0.16100,PIPA_DICDI/538-653:0.69602):0.56212,PLC1_SCHPO/637-753:0.34523,PLC1_YEAST/586-710:0.55750);
RTP  ((((PIPA_DROME/549-666,((PLCB1_BOVIN/539-656,PLCB2_HUMAN/541-658),PIP1_DROME/598-715)),PLCD1_BOVIN/430-548),PIPA_DICDI/538-653),PLC1_SCHPO/637-753,PLC1_YEAST/586-710);
RTL  4.13124
LNK  PIP1_DROME/598-715:P25455:M60452
LNK  PIPA_DICDI/538-653:Q02158:M95783
LNK  PIPA_DROME/549-666:P13217:J03138
LNK  PLC1_SCHPO/637-753:P40977:D38309
LNK  PLC1_YEAST/586-710:P32383:D12738
LNK  PLCB1_BOVIN/539-656:P10894:J03137
LNK  PLCB2_HUMAN/541-658:Q00722:M95678
LNK  PLCD1_BOVIN/430-548:P10895:M20638
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PIPA_DROME/549-666
ASQ  WLSSMVNYAQPIKFQGFDKA-IEKNIAHNMSSFAES--AGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGG-------CGYLLKPDFMR
DSQ  TGGCTCTCCTCCATGGTCAATTACGCGCAGCCCATCAAGTTCCAGGGCTTCGACAAGGCA---ATCGAAAAGAATATTGCCCACAACATGTCCTCGTTTGCGGAATCG------GCGGGCATGAACTACTTGAAGCAGAGCTCCATCGACTTTGTCAATTACAACAAGCGTCAGATGTCGCGAATTTATCCGAAGGGCACACGAGCGGACTCCTCAAACTATATGCCGCAGGTGTTCTGGAACGCCGGCTGCCAGATGGTCTCACTCAATTTCCAGAGCTCCGATTTACCCATGCAACTCAACCAGGGCAAGTTCGAGTATAATGGCGGC---------------------TGTGGCTATCTACTAAAACCGGATTTCATGCGT
TRN  11011101111011000
NAM  PLCB2_HUMAN/541-658
ASQ  EMSSLVNYIQPTKFVSFEFS-AQKNRSYVISSFTEL--KAYDLLSKASVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQ-------SGYLLKHEFMR
DSQ  GAGATGTCCAGCCTAGTCAATTACATCCAGCCCACCAAGTTCGTCTCCTTTGAGTTCTCT---GCCCAAAAGAACCGAAGTTATGTCATCTCGTCCTTCACAGAGCTC------AAGGCATATGACCTGCTCTCCAAGGCCTCGGTGCAGTTTGTGGACTACAACAAGCGCCAGATGAGCCGCATTTACCCCAAGGGAACCCGCATGGACTCCTCCAACTACATGCCCCAGATGTTCTGGAATGCTGGATGCCAGATGGTTGCCCTCAACTTCCAGACGATGGACTTGCCCATGCAGCAGAACATGGCAGTATTTGAGTTCAACGGGCAG---------------------AGCGGCTACCTCCTCAAGCATGAGTTCATGCGC
TRN  11011111101111111
NAM  PLCB1_BOVIN/539-656
ASQ  EMSNLVNYIQPVKFESFEIS-KKRNRSFEMSSFVET--KGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGK-------SGYRLKPEFMR
DSQ  GAGATGTCTAATCTGGTGAACTATATCCAGCCAGTCAAGTTCGAGTCATTTGAAATTTCA---AAAAAAAGAAATAGAAGCTTCGAGATGTCTTCCTTTGTGGAAACC------AAAGGTCTTGAGCAACTTACAAAGTCTCCGGTGGAATTTGTAGAATATAACAAAATGCAGCTTAGCAGGATATATCCAAAGGGAACACGCGTGGATTCATCTAACTATATGCCTCAGCTCTTCTGGAATGCAGGCTGCCAAATGGTTGCTCTTAATTTCCAAACAGTGGACCTGGCTATGCAGATAAACATGGGGATGTATGAATATAATGGGAAG---------------------AGTGGCTACAGGCTGAAGCCGGAGTTCATGAGG
TRN  10010101100011001
NAM  PIP1_DROME/598-715
ASQ  EISALVNYVQPIHFSSFENA-EKKNRCYEMSSFDEK--QATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNAR-------SGYLLKPEFMR
DSQ  GAGATTTCAGCTTTGGTCAACTATGTTCAGCCCATCCATTTTAGCTCTTTTGAGAATGCG---GAAAAAAAGAATCGATGCTACGAAATGTCTTCGTTTGATGAAAAA------CAGGCGACAACATTATTGAAGGAGCGACCGATTGAATTTGTGAACTACAACAAACACCAATTATCTCGTGTCTATCCGGCGGGCACTCGCTTTGATAGCTCCAACTTTATGCCGCAGTTGTTCTGGAATGCCGGATGTCAGCTCGTGGCACTTAACTTCCAAACCCTCGATCTGGCCATGCAACTCAACTTGGGGATCTTTGAGTATAACGCTCGG---------------------TCCGGTTATCTACTTAAGCCGGAGTTTATGCGC
TRN  11011101101011000
NAM  PLCD1_BOVIN/430-548
ASQ  ELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSEN--RALRLLQESGNSFVRHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGA-------CGYVLKPAFLR
DSQ  GAACTCTCCGACATGGTCATTTACTGCAAGAGTGTCCACTTTCGGGGCTTCCCCAGCTCTGGCACCTCTGGACAGGCTTTCTATGAGATGTCATCCTTCTCTGAGAAC------CGCGCCCTCCGACTGCTCCAAGAATCAGGAAACAGCTTTGTCCGCCACAACGTGAATCACCTGAGCAGGATCTACCCCGCTGGGTGGAGAACGGACTCTTCCAACTACAGCCCCGTGGAGATGTGGAATGGGGGCTGCCAGATCGTGGCCCTGAACTTCCAGACTCCTGGGTCAGAGATGGATGTGTACCAGGGCCGCTTCCTGGACAATGGGGCC---------------------TGTGGGTACGTGCTGAAGCCTGCCTTCCTGCGA
TRN  10010101100011001
NAM  PIPA_DICDI/538-653
ASQ  EFEELI-YLVSHGFKSGNTT--KEIPSYKIHSLVEE--KVKQLVQSEPREVVEASQNHLLRVYPRGTRFDSSNFDPMPGWSIGCQLAALNQQTSSEPMWINDGMFSDNGG-------CGYVLKPPCLL
DSQ  GAATTTGAAGAATTAATT---TATTTAGTTTCACATGGATTTAAATCTGGTAATACTACA------AAAGAAATTCCATCATATAAAATTCATTCATTGGTTGAGGAG------AAAGTTAAACAATTGGTACAATCTGAACCAAGAGAGGTCGTTGAAGCATCACAAAATCATTTACTTAGAGTTTATCCAAGAGGTACTCGTTTCGATAGTAGCAATTTTGATCCAATGCCAGGTTGGAGTATTGGTTGTCAATTGGCAGCTTTGAATCAACAAACTTCATCGGAACCAATGTGGATCAATGATGGTATGTTCTCAGATAATGGTGGT---------------------TGTGGCTACGTTTTAAAACCACCTTGTCTTTTA
TRN  10010101110011000
NAM  PLC1_YEAST/586-710
ASQ  DVSNIS-GIHGIKFRNFSLP--ESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLL
DSQ  GATGTTTCTAACATTTCT---GGAATACATGGCATCAAGTTCAGGAATTTCTCTTTACCA------GAGTCCAAAACGATAGCGCATTGTTTTTCACTGAATGAGCGCAAAGTAGAATACATGATAAAAGACAAACACTTAAAATTATCGTTGGATAAACATAATAGAAGATATTTGATGAGAGTCTATCCTCACGTTTTACGATACAAATCATCAAATTTTAACCCAATACCTTTTTGGAAGGCCGGTGTACAAATGGTGGCTACGAATTGGCAAACTAATGATATTGGACAGCAACTTAATCTGGCAATGTTTCAAATATTAGATCACCAACCTGATGGAAGTTTTAAATCAGGATACGTGCTAAAACCAAAAAAGTTGCTA
TRN  10010101100011000
NAM  PLC1_SCHPO/637-753
ASQ  ELQQLAPYARSLKFRNFSLP--ESKTYSHIFSFSER--TIKKHGKAMVPRLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRLGVQMVALNWQTYDTGLQINDALFIADPP-------TGYLLKPPCQR
DSQ  GAATTGCAACAGCTTGCACCTTATGCCCGATCATTGAAATTTCGAAATTTTTCTTTACCG------GAATCAAAAACGTATAGCCACATATTCTCATTTTCGGAAAGG------ACTATAAAAAAGCATGGAAAAGCTATGGTTCCAAGACTTAGCAAACATAATTTACGCTATTTGTGTCGTGTATACCCTGGCCCATTGAGAGTAGGAAGTACAAATTTTAATCCTCAGGTGTATTGGCGCCTGGGTGTGCAAATGGTTGCTCTAAACTGGCAAACTTATGATACAGGTCTTCAAATAAATGATGCTTTGTTTATAGCTGATCCTCCG---------------------ACTGGGTACTTGTTAAAGCCACCTTGTCAACGA
TRN  10010101100011000
//