EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00366 - Ribosomal_S17)
FAM  PF00366
PID  Ribosomal_S17
DES  Ribosomal protein S17
IPR  IPR000266
ANO  15
ALN  71
AID  0.449355
APH  ((((((((((RS17_THETH/7-75:0.24330,(RR17_ARATH/55-123:0.16505,RR17_PEA/43-111:0.19731):0.58874):0.11893,(RS17_BACST/11-79:0.07423,RS17_MYCCA/11-79:0.18450):0.19677):0.11173,RS17_CHLTR/14-81:0.53299):0.05440,RS17_THEMA/8-76:0.08210):0.09361,RR17_CYAPA/8-76:0.77816):0.18569,RS17_BUCAK/10-78:0.12452):0.61185,RS17_HALMA/33-102:0.32789):0.26604,RS17_METVA/35-104:0.52005):0.40585,(RS11_RAT/75-145:0.14603,RS11_YEAST/72-141:0.12741):0.07336):0.14811,RS11A_ARATH/74-143:0.16265,RS11_DUNTE/73-142:0.09206);
ATP  ((((((((((RS17_THETH/7-75,(RR17_ARATH/55-123,RR17_PEA/43-111)),(RS17_BACST/11-79,RS17_MYCCA/11-79)),RS17_CHLTR/14-81),RS17_THEMA/8-76),RR17_CYAPA/8-76),RS17_BUCAK/10-78),RS17_HALMA/33-102),RS17_METVA/35-104),(RS11_RAT/75-145,RS11_YEAST/72-141)),RS11A_ARATH/74-143,RS11_DUNTE/73-142);
ATL  6.61334
DNO  14
DLN  213
DID  0.474205
DPH  ((((((((RS17_BUCAK/10-78:0.29721,((RR17_CYAPA/8-76:0.51403,(RS17_CHLTR/14-81:0.36120,RS17_MYCCA/11-79:0.26172):0.08253):0.13716,RS17_THEMA/8-76:0.17831):0.13624):0.19845,RS17_THETH/7-75:0.22401):0.08651,(RR17_ARATH/55-123:0.13514,RR17_PEA/43-111:0.31639):0.20718):0.26443,RS17_HALMA/33-102:0.30842):0.19035,RS17_METVA/35-104:0.61937):0.14479,RS11_YEAST/72-141:0.17250):0.03453,RS11_RAT/75-145:0.20815):0.10325,RS11A_ARATH/74-143:0.26988,RS11_DUNTE/73-142:0.12697);
DTP  ((((((((RS17_BUCAK/10-78,((RR17_CYAPA/8-76,(RS17_CHLTR/14-81,RS17_MYCCA/11-79)),RS17_THEMA/8-76)),RS17_THETH/7-75),(RR17_ARATH/55-123,RR17_PEA/43-111)),RS17_HALMA/33-102),RS17_METVA/35-104),RS11_YEAST/72-141),RS11_RAT/75-145),RS11A_ARATH/74-143,RS11_DUNTE/73-142);
DTL  5.57872
RID  0.443991
RPH  (((((RS17_THEMA/8-76:0.04528,(RR17_CYAPA/8-76:0.75968,(RS17_BUCAK/10-78:0.14371,(RS17_HALMA/33-102:0.33602,(RS17_METVA/35-104:0.51737,((RS11A_ARATH/74-143:0.16271,RS11_DUNTE/73-142:0.09232):0.14778,(RS11_RAT/75-145:0.14613,RS11_YEAST/72-141:0.12786):0.07417):0.40685):0.26074):0.59480):0.18581):0.12409):0.07779,RS17_CHLTR/14-81:0.52113):0.09569,RS17_MYCCA/11-79:0.38145):0.11360,RS17_THETH/7-75:0.26809):0.56833,RR17_ARATH/55-123:0.13571,RR17_PEA/43-111:0.22459);
RTP  (((((RS17_THEMA/8-76,(RR17_CYAPA/8-76,(RS17_BUCAK/10-78,(RS17_HALMA/33-102,(RS17_METVA/35-104,((RS11A_ARATH/74-143,RS11_DUNTE/73-142),(RS11_RAT/75-145,RS11_YEAST/72-141))))))),RS17_CHLTR/14-81),RS17_MYCCA/11-79),RS17_THETH/7-75),RR17_ARATH/55-123,RR17_PEA/43-111);
RTL  6.54094
LNK  RR17_ARATH/55-123:P16180:Z11151
LNK  RR17_CYAPA/8-76:P23404:M30487
LNK  RR17_PEA/43-111:P17092:M31025
LNK  RS11A_ARATH/74-143:P16181:L28828
LNK  RS11_DUNTE/73-142:P42756:X66036
LNK  RS11_RAT/75-145:P62282:K03250
LNK  RS11_YEAST/72-141:P26781:L15408
LNK  RS17_BACST/11-79:P23828:
LNK  RS17_BUCAK/10-78:P46175:D31786
LNK  RS17_CHLTR/14-81:P28545:M80325
LNK  RS17_HALMA/33-102:P12741:X55311
LNK  RS17_METVA/35-104:P14042:X16720
LNK  RS17_MYCCA/11-79:P10131:X06414
LNK  RS17_THEMA/8-76:P38519:AE001798
LNK  RS17_THETH/7-75:P24321:X56552
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RS11_YEAST/72-141
ASQ  GTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR-VQVGDIVTVGQCRPISKTVRFNVVKV
DSQ  GGTACCGTCGTCTCCACCAAGATGCACCGTACCATTGTCATCAGAAGGGCTTACTTGCATTACATTCCAAAGTACAACAGATACGAAAAGAGACACAAGAACGTTCCAGTTCACGTTTCCCCAGCTTTCCGT---GTCCAAGTTGGTGACATCGTTACCGTCGGCCAATGTAGACCAATCTCCAAGACTGTTAGATTCAACGTTGTCAAGGTC
TRN  10110101110011011
NAM  RS11_RAT/75-145
ASQ  GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKV
DSQ  GGTGTTGTGACGAAGATGAAGATGCAGAGGACCATTGTCATCCGCCGGGACTATCTCCATTATATCCGAAAGTACAACCGCTTTGAGAAGCGTCACAAGAACATGTCTGTGCACCTGTCCCCCTGTTTCAGGGACGTCCAGATTGGCGACATTGTCACTGTTGGAGAGTGCAGGCCTCTGAGCAAGACTGTTCGATTCAATGTGCTCAAGGTC
TRN  10010101100011011
NAM  RS11_DUNTE/73-142
ASQ  GVVKSSKMMRTIIVRRDYLHFIPKYARYEKRHTNIPAHVSPCFR-VRDGDTVIIGQCRPLSKTIRFNVLRV
DSQ  GGCGTCGTGAAGTCCTCCAAGATGATGCGCACCATCATCGTGCGCAGGGACTACCTGCATTTCATCCCCAAGTATGCCCGGTATGAGAAGAGGCACACCAACATCCCAGCACACGTCTCCCCATGCTTCCGT---GTAAGGGATGGAGACACCGTCATCATTGGCCAGTGCAGGCCTCTGTCCAAGACCATCCGATTCAACGTGCTGCGTGTC
TRN  10010101100011011
NAM  RS11A_ARATH/74-143
ASQ  GTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHIIIGQCRPLSKTVRFNVLKV
DSQ  GGTACTTGCCACAGTGCGAAAATGCAGAGGACCATTATCGTGCGAAGGGATTACCTTCACTTTGTGAAGAAGTATCAGAGGTATGAGAAGAGGCATTCAAACATTCCGGCTCATGTCTCACCATGCTTCCGT---GTTAAGGAAGGAGACCATATCATCATTGGCCAATGCAGGCCATTGTCGAAGACAGTGAGGTTCAATGTGTTGAAGGTG
TRN  10010101110011001
NAM  RS17_METVA/35-104
ASQ  GVVSGDKGHNTIVIKREVTGYISKYERYEKRTTSLVAHNPPCIN-AKTGDVVKVMECRPVSKTKSFVVIEK
DSQ  GGTGTCGTTTCAGGCGACAAAGGTCACAACACTATTGTGATAAAAAGAGAAGTAACTGGATACATCTCAAAATATGAAAGATATGAAAAAAGAACAACTTCGTTGGTTGCGCACAACCCGCCATGTATCAAT---GCAAAAACTGGCGATGTTGTGAAAGTTATGGAATGCAGGCCAGTCAGTAAAACAAAATCATTTGTTGTTATTGAAAAA
TRN  10010101110011001
NAM  RS17_HALMA/33-102
ASQ  GEVASTDMEKTVVVEREYDVKVPKYDRFMKRRSRVPAHAPDCLD-LAVGDTVTIAECRPLSKTKSHVVVGV
DSQ  GGCGAGGTAGCCTCCACTGACATGGAGAAGACCGTTGTCGTCGAGCGCGAGTACGACGTGAAGGTGCCGAAATACGACCGCTTTATGAAGCGGCGGAGCCGCGTTCCGGCTCACGCACCGGACTGTCTCGAC---CTCGCGGTCGGTGACACGGTCACGATAGCAGAGTGTCGACCGCTCTCGAAAACGAAAAGCCACGTCGTCGTTGGCGTG
TRN  10010101110011011
NAM  RS17_THETH/7-75
ASQ  GVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEERYKV--GDVVEIIEARPISKRKRFRVLRL
DSQ  GGGGTGGTGGTGAGCGACAAGATGCAGAAGACCGTGACGGTCTTGGTGGAGCGCCAGTTCCCCCACCCCCTTTACGGCAAGGTCATCAAGCGCTCCAAAAAGTACCTGGCCCATGACCCCGAGGAGCGGTACAAGGTG------GGGGACGTGGTGGAGATCATAGAGGCCCGCCCCATCTCCAAGCGCAAGCGATTCCGGGTCCTGCGCTTG
TRN  10010101100011011
NAM  RS17_MYCCA/11-79
ASQ  GKVVSDKMDKTITVLVETYKNHPIYKKRVKYSKKYKAHDENQVAQM--GDKVEIMETRPLSKTKNFRLVRV
DSQ  GGTAAGGTTGTATCAGATAAAATGGATAAAACTATTACTGTATTAGTTGAAACTTATAAAAACCACCCAATTTATAAAAAGAGAGTTAAATATTCTAAAAAATATAAAGCACATGATGAAAACCAAGTTGCTCAAATG------GGTGATAAAGTTGAAATTATGGAAACACGTCCTTTATCAAAAACTAAAAACTTTAGATTAGTTAGAGTT
TRN  10110101110011000
NAM  RS17_BACST/11-79
ASQ  GRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKV--GDIVKIMETRPLSATKRFRLVEI
NAM  RS17_BUCAK/10-78
ASQ  GRVVSHKMEKSIVVAIERTVKHPIYGKFIKRTTKLHVHDENNECGI--GDVVEIRECRPLSKTKSWTLVRV
DSQ  GGGCGTGTTGTGAGTCACAAAATGGAGAAATCCATTGTTGTTGCTATTGAGCGCACGGTGAAACACCCAATCTATGGGAAATTCATCAAGCGTACAACCAAACTGCACGTACATGACGAGAACAACGAATGTGGTATC------GGCGACGTGGTGGAAATCCGCGAATGCCGCCCATTGTCCAAGACTAAGTCCTGGACGTTGGTTCGCGTT
TRN  11011101101011011
NAM  RS17_THEMA/8-76
ASQ  GIVVSDKMDKTVVVAVEKLVQHPLYKKYVKRTKKYHAHDERNECKI--GDVVEIEETRPLSKTKRWRVVRI
DSQ  GGAATAGTTGTGAGCGATAAAATGGACAAGACAGTGGTTGTTGCCGTGGAAAAACTCGTACAGCACCCGCTTTACAAAAAGTACGTGAAAAGAACGAAAAAATATCACGCACACGACGAGAGGAACGAATGTAAAATA------GGAGATGTTGTTGAAATAGAAGAGACAAGGCCTCTCAGCAAAACGAAGAGATGGAGAGTCGTCAGGATC
TRN  10010101110011011
NAM  RS17_CHLTR/14-81
ASQ  GVVVSSKMEKTVVVRVERVYSHPQYAKVVRDSSKYYAHN-ELDVKE--GDTVRIQETRPLSKTKRWRVVGR
DSQ  GGTGTAGTAGTCTCATCAAAAATGGAAAAAACTGTTGTTGTTCGAGTCGAAAGGGTATACTCGCACCCTCAATATGCTAAGGTGGTTAGGGATTCTAGCAAGTATTATGCGCATAAT---GAGTTGGATGTGAAAGAA------GGTGATACTGTTCGAATCCAAGAGACGCGTCCTTTGTCTAAAACGAAGAGATGGCGGGTTGTCGGACGT
TRN  10110101110011001
NAM  RR17_PEA/43-111
ASQ  GKVVCASGNKTVAVEVTRLAPHPKYQKRIRLKKKYQAHDPENDFKV--GDIVQLLKTRPISKKKTFLAVPA
DSQ  GGAAAGGTCGTATGCGCCAGCGGCAACAAGACGGTGGCGGTGGAGGTTACCCGTTTGGCACCTCATCCGAAATACCAAAAGCGAATCAGGCTGAAGAAGAAGTATCAGGCTCATGATCCTGAAAACGATTTCAAGGTC------GGTGATATTGTTCAGCTTCTTAAAACTAGACCGATTAGCAAGAAAAAGACCTTTCTCGCTGTTCCTGCT
TRN  10010101100011011
NAM  RR17_ARATH/55-123
ASQ  GRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKV--GDVVRLEKSRPISKTKSFVALPV
DSQ  GGGCGCGTGGTGTGCGCAACCAGTGACAAGACTGTGGCGGTGGAGGTGGTGAGGCTGGCTCCCCACCCCAAGTACAAGAGGCGCGTGAGGATGAAGAAGAAGTACCAAGCTCACGACCCCGATAATCAGTTCAAGGTT------GGCGACGTGGTCAGACTGGAAAAGAGCAGACCCATCAGTAAGACTAAATCATTTGTGGCGCTTCCTGTC
TRN  10010101100011001
NAM  RR17_CYAPA/8-76
ASQ  GVVIRNPQEKTVIVAVNNRVRHNKYSKIIIRTKKYQVHDHSHICKL--GDEVKISEVKPISKTKRWIISEV
DSQ  GGTGTAGTTATTCGAAATCCACAAGAGAAAACAGTAATTGTTGCTGTTAATAATCGAGTAAGACACAATAAATATTCTAAAATTATTATTCGAACAAAAAAATATCAAGTTCATGATCATTCTCATATTTGTAAACTT------GGTGATGAAGTAAAAATTTCTGAAGTTAAACCTATAAGTAAAACCAAACGTTGGATTATTTCGGAAGTT
TRN  10010101110011011
//