EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00268 - Ribonuc_red_sm)
FAM  PF00268
PID  Ribonuc_red_sm
DES  Ribonucleotide reductase, small chain
IPR  IPR000358
ANO  13
ALN  299
AID  0.364395
APH  (((((((RIR2_CAEEL/62-343:0.25532,RIR2_HUMAN/70-351:0.13343):0.07260,(RIR2_SCHPO/66-348:0.15694,RIR2_YEAST/76-358:0.17431):0.07654):0.05356,RIR2_DICDI/12-293:0.17748):0.35082,RIR2_ASFB7/9-294:0.51588):0.45952,RIR4_SALTY/1-281:1.61134):0.39602,((RIR2_HHV11/28-314:0.30755,(RIR2_BHV1C/7-288:0.23199,RIR2_EHV1B/12-295:0.18410):0.05376):0.13737,RIR2_VZVD/1-280:0.19435):0.37543):0.40997,RIR2_EBV/1-276:0.28804,RIR2_SHV21/1-279:0.26068);
ATP  (((((((RIR2_CAEEL/62-343,RIR2_HUMAN/70-351),(RIR2_SCHPO/66-348,RIR2_YEAST/76-358)),RIR2_DICDI/12-293),RIR2_ASFB7/9-294),RIR4_SALTY/1-281),((RIR2_HHV11/28-314,(RIR2_BHV1C/7-288,RIR2_EHV1B/12-295)),RIR2_VZVD/1-280)),RIR2_EBV/1-276,RIR2_SHV21/1-279);
ATL  6.87865
DNO  13
DLN  897
DID  0.452788
DPH  (((((RIR2_HHV11/28-314:0.21444,RIR2_BHV1C/7-288:0.22441):0.05417,RIR2_EHV1B/12-295:0.21009):0.10450,RIR2_VZVD/1-280:0.31329):0.22521,((RIR2_ASFB7/9-294:0.41353,((RIR2_DICDI/12-293:0.26573,RIR2_CAEEL/62-343:0.25743):0.06191,(RIR2_HUMAN/70-351:0.23534,(RIR2_SCHPO/66-348:0.23113,RIR2_YEAST/76-358:0.21931):0.06810):0.03679):0.23552):0.34105,RIR4_SALTY/1-281:0.90848):0.23100):0.23345,RIR2_EBV/1-276:0.20207,RIR2_SHV21/1-279:0.44314);
DTP  (((((RIR2_HHV11/28-314,RIR2_BHV1C/7-288),RIR2_EHV1B/12-295),RIR2_VZVD/1-280),((RIR2_ASFB7/9-294,((RIR2_DICDI/12-293,RIR2_CAEEL/62-343),(RIR2_HUMAN/70-351,(RIR2_SCHPO/66-348,RIR2_YEAST/76-358)))),RIR4_SALTY/1-281)),RIR2_EBV/1-276,RIR2_SHV21/1-279);
DTL  5.73009
RID  0.364395
RPH  (((((((RIR2_CAEEL/62-343:0.25532,RIR2_HUMAN/70-351:0.13343):0.07260,(RIR2_SCHPO/66-348:0.15694,RIR2_YEAST/76-358:0.17431):0.07654):0.05356,RIR2_DICDI/12-293:0.17748):0.35082,RIR2_ASFB7/9-294:0.51588):0.45952,RIR4_SALTY/1-281:1.61134):0.39602,((RIR2_HHV11/28-314:0.30755,(RIR2_BHV1C/7-288:0.23199,RIR2_EHV1B/12-295:0.18410):0.05376):0.13737,RIR2_VZVD/1-280:0.19435):0.37543):0.40997,RIR2_EBV/1-276:0.28804,RIR2_SHV21/1-279:0.26068);
RTP  (((((((RIR2_CAEEL/62-343,RIR2_HUMAN/70-351),(RIR2_SCHPO/66-348,RIR2_YEAST/76-358)),RIR2_DICDI/12-293),RIR2_ASFB7/9-294),RIR4_SALTY/1-281),((RIR2_HHV11/28-314,(RIR2_BHV1C/7-288,RIR2_EHV1B/12-295)),RIR2_VZVD/1-280)),RIR2_EBV/1-276,RIR2_SHV21/1-279);
RTL  6.87865
LNK  RIR2_ASFB7/9-294:P42492:U18466
LNK  RIR2_BHV1C/7-288:Q01319:Z54206
LNK  RIR2_CAEEL/62-343:P42170:Z35637
LNK  RIR2_DICDI/12-293:P42521:L36941
LNK  RIR2_EBV/1-276:P03175:V01555
LNK  RIR2_EHV1B/12-295:P28847:AY665713
LNK  RIR2_HHV11/28-314:P10224:X14112
LNK  RIR2_HUMAN/70-351:P31350:X59618
LNK  RIR2_SCHPO/66-348:P36603:AL031158
LNK  RIR2_SHV21/1-279:Q01038:X64346
LNK  RIR2_VZVD/1-280:P09247:X04370
LNK  RIR2_YEAST/76-358:P09938:M17789
LNK  RIR4_SALTY/1-281:P17424:X73226
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RIR4_SALTY/1-281
ASQ  MKLSRISAINW--NKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQT-LSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLC--QTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEP-LKKK-IASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYAETGW------...VNDVKAFLCYNANKALMNLGYEALFPPEM--ADVNPA
DSQ  ATGAAATTATCTCGTATTAGCGCCATCAACTGG------AACAAGATCCAGGACGACAAAGATCTGGAGGTATGGAACCGGCTGACCAGTAACTTCTGGCTGCCGGAAAAAGTGCCGTTATCGAATGATATTCCGGCCTGGCAGACG---CTGAGCGCCGCCGAACAGCAGCTCACCATTCGCGTGTTTACGGGACTTACGCTGCTCGACACTATCCAGAACATCGCAGGCGCGCCGTCGTTAATGGCAGATGCCATCACGCCGCATGAAGAGGCAGTGCTGTCGAACATCAGCTTTATGGAAGCGGTACACGCCCGCTCTTACAGTTCTATTTTCTCCACGCTGTGC------CAGACGAAAGAGGTTGATGCCGCCTACGCCTGGAGCGAAGAAAACCCACCGCTTCAGCGTAAGGCGCAGATTATTTTAGCTCATTACGTCAGCGATGAACCG---CTAAAGAAAAAG---ATTGCCAGCGTCTTTTTAGAGTCTTTTCTGTTCTATTCCGGCTTCTGGTTGCCGATGTATTTCTCCAGCCGCGGTAAGCTCACGAACACTGCCGACCTGATTCGTTTAATCATTCGCGATGAAGCGGTTCACGGTTATTATATTGGCTATAAGTATCAGATAGCGCTACAAAAACTATCGGCAATCGAGCGTGAAGAGTTAAAGCTTTTCGCGCTGGATTTGTTGATGGAACTGTACGACAACGAAATCCGCTACACAGAAGCGTTATATGCGGAAACCGGCTGG------------------.........GTTAACGACGTCAAAGCCTTCTTGTGCTACAACGCCAATAAAGCCTTAATGAACCTGGGTTATGAGGCGTTATTTCCGCCGGAGATG------GCAGACGTGAATCCCGCA
TRN  10010101100011010
NAM  RIR2_YEAST/76-358
ASQ  EPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI-KDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLK---NKPDPAIV----EKIVTEAVEIEQRYFL---DALPVALLGMN...ADLMNQYVEFVADRLLVAFGNKKYYKVEN--PFDFME
DSQ  GAACCTTTGTTGAATGAAGACAAGGAGAGAACTGTTCTTTTCCCTATCAAGTACCATGAAATCTGGCAAGCCTACAAGCGTGCCGAAGCTTCTTTCTGGACCGCTGAAGAAATTGATTTGTCTAAGGATATCCATGACTGGAACAACAGAATGAACGAAAACGAGAGATTTTTCATTTCCAGAGTTCTTGCCTTTTTCGCCGCTTCTGACGGTATTGTTAATGAAAACTTGGTTGAAAACTTCTCCACCGAAGTCCAAATTCCAGAGGCAAAGAGTTTCTACGGTTTCCAAATCATGATTGAAAATATTCACTCTGAAACTTACTCCTTGTTGATCGATACCTACATC---AAGGACCCTAAAGAAAGTGAATTCTTGTTCAATGCCATTCACACCATCCCAGAAATCGGTGAGAAGGCCGAATGGGCTTTAAGATGGATTCAAGACGCTGACGCCTTGTTTGGTGAAAGACTAGTTGCCTTTGCCTCCATTGAAGGTGTCTTTTTCTCCGGTTCCTTTGCCTCCATTTTCTGGTTGAAAAAGAGAGGTATGATGCCCGGTTTAACCTTTTCCAACGAATTGATCTGTAGAGACGAAGGTTTGCACACCGACTTTGCATGCTTGTTGTTCGCCCATTTGAAG---------AACAAACCAGACCCAGCCATTGTT------------GAAAAAATTGTCACCGAGGCTGTGGAAATTGAACAAAGATACTTCTTG---------GACGCCTTACCAGTTGCTTTGCTAGGTATGAAC.........GCTGACTTAATGAACCAATACGTTGAGTTCGTCGCCGACAGACTGTTGGTTGCTTTCGGTAACAAGAAATACTACAAGGTCGAAAAC------CCCTTCGATTTCATGGAA
TRN  10010101100011010
NAM  RIR2_SCHPO/66-348
ASQ  EVVLRPNPHRFVLFPIKYHEIWQFYKKAEASFWTAEEIDLSKDLVDWDNKLNADERYFISTVLAYFAASDGIVNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLLLDTYI-REPKEKQRHFDAILTMGSIKAKAKWALRWINDEDSTYAIRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHLK---HRPGRKVV----EAIIVEAVDIEKEYFT---DALPVSLLGMN...KDLMCQYIEFVADRLLVALGNDKYYNVTN--PFDFME
DSQ  GAAGTTGTGCTTCGCCCTAATCCTCACCGCTTTGTTTTGTTTCCAATTAAGTATCACGAAATTTGGCAATTCTACAAGAAGGCTGAAGCATCTTTTTGGACTGCTGAGGAAATTGATCTTTCGAAAGACTTGGTTGATTGGGATAACAAGTTAAATGCTGATGAACGTTACTTTATTTCCACTGTACTCGCCTATTTCGCTGCGTCAGATGGTATTGTTAATGAGAATCTTCTCGAGCGTTTCAGCTCTGAAGTTCAGATCCCTGAAGCTCGTTGTGTTTATGGTTTCCAAATTATGATTGAAAATATTCACTCTGAGACCTACTCACTTTTGCTTGATACATACATT---CGTGAACCTAAGGAAAAACAGCGTCATTTCGATGCTATTTTAACAATGGGTTCTATTAAGGCCAAAGCCAAGTGGGCTCTTCGTTGGATTAATGATGAAGATTCCACCTATGCAATTCGTTTGGTTGCCTTTGCTGCTGTAGAAGGTATCTTCTTTTCTGGATCGTTTGCCTCTATTTTTTGGCTTAAGAAACGTGGACTTATGCCTGGTCTTACTTTTTCCAATGAATTGATTTGTCGTGATGAGGGTCTTCACACCGACTTTGCCTGTTTGATGTTTAGTCATTTGAAG---------CACAGACCAGGCCGCAAGGTTGTT------------GAAGCCATTATTGTTGAAGCTGTTGATATTGAGAAAGAATACTTCACG---------GACGCTCTTCCCGTTAGTCTGCTTGGTATGAAT.........AAGGATTTGATGTGTCAGTATATTGAATTTGTTGCTGATCGTTTGTTGGTTGCTTTGGGCAATGACAAGTACTATAACGTAACCAAT------CCTTTCGATTTCATGGAG
TRN  10010101100011000
NAM  RIR2_HUMAN/70-351
ASQ  EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES-LKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYI-KDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV---HKPSEERV----REIIINAVRIEQEFLT---EALPVKLIGMN...CTLMKQYIEFVADRLMLELGFSKVFRVEN--PFDFME
DSQ  GAGCCGCTGCTGAGAGAAAACCCCCGCCGCTTTGTCATCTTCCCCATCGAGTACCATGATATCTGGCAGATGTATAAGAAGGCAGAGGCTTCCTTTTGGACCGCCGAGGAGGTTGACCTCTCCAAGGACATTCAGCACTGGGAATCC---CTGAAACCCGAGGAGAGATATTTTATATCCCATGTTCTGGCTTTCTTTGCAGCAAGCGATGGCATAGTAAATGAAAACTTGGTGGAGCGATTTAGCCAAGAAGTTCAGATTACAGAAGCCCGCTGTTTCTATGGCTTCCAAATTGCCATGGAAAACATACATTCTGAAATGTATAGTCTTCTTATTGACACTTACATA---AAAGATCCCAAAGAAAGGGAATTTCTCTTCAATGCCATTGAAACGATGCCTTGTGTCAAGAAGAAGGCAGACTGGGCCTTGCGCTGGATTGGGGACAAAGAGGCTACCTATGGTGAACGTGTTGTAGCCTTTGCTGCAGTGGAAGGCATTTTCTTTTCCGGTTCTTTTGCGTCGATATTCTGGCTCAAGAAACGAGGACTGATGCCTGGCCTCACATTTTCTAATGAACTTATTAGCAGAGATGAGGGTTTACACTGTGATTTTGCTTGCCTGATGTTCAAACACCTGGTA---------CACAAACCATCGGAGGAGAGAGTA------------AGAGAAATAATTATCAATGCTGTTCGGATAGAACAGGAGTTCCTCACT---------GAGGCCTTGCCTGTGAAGCTCATTGGGATGAAT.........TGCACTCTAATGAAGCAATACATTGAGTTTGTGGCAGACAGACTTATGCTGGAACTGGGTTTTAGCAAGGTTTTCAGAGTAGAGAAC------CCATTTGACTTTATGGAG
TRN  10010101100011010
NAM  RIR2_CAEEL/62-343
ASQ  EPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEK-MNGDEQYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYI-RDETERNTLFNAVDEFEFIKKKADWALRWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQ---KKLTQQRI----YDIIKDAVAIEQEFLT---EALPVDMIGMN...CRLMSQYIEFVADHLLVELGCDKLYKSKN--PFDFME
DSQ  GAGCCGATGCTTCAAGATTTGGATAATCGATTCGTCATCTTCCCACTGAAACATCATGACATCTGGAACTTCTACAAAAAGGCAGTTGCATCATTCTGGACAGTCGAAGAAGTCGATCTTGGAAAGGATATGAACGATTGGGAGAAG---ATGAATGGTGACGAGCAATACTTCATTTCTCGGATCCTTGCCTTCTTTGCCGCATCGGACGGAATTGTCAATGAGAACTTGTGCGAACGATTCTCGAACGAAGTTCAAGTCTCAGAAGCACGGTTTTTCTACGGATTCCAGATTGCCATTGAGAACATTCATTCAGAGATGTACTCGAAGCTGATTGAGACTTATATT---CGTGATGAGACGGAACGAAACACTCTTTTCAACGCCGTTGATGAGTTCGAGTTCATCAAGAAGAAGGCTGACTGGGCTCTTCGCTGGATTTCGGACAAGAAGGCTTCGTTCGCTGAAAGACTCATTGCTTTCGCAGCTGTTGAGGGAATCTTCTTCAGTGGATCATTCGCTTCGATCTTCTGGCTGAAGAAGCGTGGATTGATGCCAGGATTGACACATTCCAATGAGCTCATCTCGAGAGACGAAGGACTTCATCGTGATTTCGCCTGTCTTCTCTACTCAAAGCTTCAA---------AAGAAACTCACTCAACAACGCATC------------TACGATATCATCAAGGACGCTGTGGCCATCGAACAAGAATTCCTGACT---------GAGGCACTTCCAGTTGACATGATTGGCATGAAC.........TGTCGTCTTATGTCACAGTACATCGAGTTTGTCGCCGATCATTTGCTCGTCGAGCTCGGTTGTGACAAGCTTTACAAGTCGAAGAAT------CCATTCGACTTCATGGAG
TRN  10010101100011001
NAM  RIR2_DICDI/12-293
ASQ  EPILKENKDRFVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWEYKLTDNERHFISHVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIETYI-KDKQTKDKLFNAIETIPCIKKKAEWALRWINDSDS-FAERLVAFAAVEGIFFSGSFCSIFWLKKRGLMQGLTFSNELISRDEGLHCDFACLLYTKLQ---RKLDPKVI----EKMIRDAVECEKEFIC---ESLPVDLIGMN...SRSMSQYIEFCADRLVVSLGYKKIFNSSN--PFEWME
DSQ  GAACCAATTCTCAAAGAAAATAAAGATAGATTTGTATTATTTCCAATAAAATACCCAGATATCTGGAGAATGTATAAAAAAGCCCTTGCAAGTCATTGGGTAGCTGAAGAAATTGATCTTGGTAATGATAATGTTGATTGGGAATATAAATTAACAGATAATGAACGTCATTTCATCTCACATGTTTTGGCATTTTTTGCTGCATCTGATGGTATTGTAAATGAAAACCTTGCAACTAGATTTATGTCTGAAGTACAAATTCCAGAAGCAAGATGTTTCTATGGTTTTCAAATTGCAATTGAAAATATACATTCTGAAACTTATAGTCTTTTAATTGAAACTTATATT---AAAGATAAGCAAACTAAAGATAAATTATTTAATGCAATTGAAACAATTCCATGTATTAAAAAGAAGGCAGAATGGGCATTAAGATGGATAAATGATTCAGATTCA---TTTGCAGAACGTTTGGTTGCATTTGCAGCAGTTGAGGGTATATTTTTCAGTGGAAGTTTTTGTTCAATATTTTGGTTGAAAAAGAGAGGTTTAATGCAAGGTTTAACATTTTCAAATGAATTAATTTCACGTGACGAAGGTTTACATTGTGATTTCGCATGTCTTCTCTACACAAAGTTACAA---------AGAAAGTTGGATCCAAAAGTCATT------------GAGAAAATGATAAGAGATGCTGTCGAATGTGAAAAGGAATTCATTTGC---------GAATCATTACCAGTGGATTTAATTGGTATGAAC.........TCGCGTTCAATGTCTCAATACATTGAGTTTTGTGCTGATCGTTTAGTGGTTTCTTTAGGTTACAAAAAGATTTTCAACTCTTCAAAT------CCTTTCGAATGGATGGAA
TRN  10010101110011000
NAM  RIR2_ASFB7/9-294
ASQ  EELLIENSQRFTIFPIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKPQREFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLI-PDEKEQQRIFSGIEKHPIIKKMAQWVRQWMDPDRNTLGERLVGFAAVEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDEGVHCSFACFLISNYVY--NIPEEKII----HKILKEAVELVDEFINYAFDKARGRVPGFS...KEMLFQYIRYFTDNLCFMMQCKSIYKVGN--PFPQMT
DSQ  GAGGAATTACTAATTGAAAATTCCCAACGTTTCACTATTTTTCCTATTCAGCACCCCGAATGTTGGAACTGGTATAAAAAATTAGAAAGTTTGACGTGGACGGCGCAGGAGGTAGACATGTGTAAGGACATTGATGATTGGGAAGCC---ATGCCAAAGCCACAGCGCGAATTTTATAAACAAATTTTAGCCTTCTTTGTTGTTGCCGACGAAATTGTTATCGAAAACCTTTTAACCAATTTTATGCGCGAAATTAAAGTAAAGGAAGTGTTATACTTTTATACAATGCAGGCTGCCCAAGAGTGTGTTCATAGTGAAGCCTACTCAATACAGGTAAAAACGCTGATC---CCGGATGAGAAGGAACAACAGCGCATCTTTAGCGGCATTGAAAAACACCCTATCATAAAAAAAATGGCGCAGTGGGTGCGGCAGTGGATGGACCCCGACAGGAACACTCTGGGTGAGCGGCTGGTGGGCTTCGCCGCCGTAGAAGGCATTTTATTTCAAAACCACTTTGTGGCGATCCAGTTTCTTAAGGAACAGAATATTATGCCGGGGCTTGTAAGCTATAATGAGTTTATTTCACGCGATGAGGGGGTGCACTGTAGTTTTGCGTGTTTTCTTATCTCGAATTACGTGTAT------AACATTCCCGAGGAAAAGATCATT------------CACAAAATTTTGAAGGAGGCTGTGGAGTTGGTGGATGAGTTCATTAACTATGCCTTTGACAAGGCAAGAGGAAGAGTTCCCGGTTTTTCA.........AAAGAAATGCTGTTTCAATATATACGCTACTTTACAGATAATTTGTGCTTCATGATGCAGTGCAAAAGTATTTATAAAGTGGGAAAC------CCTTTTCCTCAGATGACT
TRN  10010101100011000
NAM  RIR2_VZVD/1-280
ASQ  MDQ-KDCSHFF--YRPECPDINNLRALSISNRWLESDFIIEDDYQYLDC-LTEDELIFYRFIFTFLSAADDLVNVNL-GSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLMLFRGDESLRVQYVNVTINNPSIQQKVQWLEEKVRDNPS-VAEKYILMILIEGIFFVSSFAAIAYLRNNGLFVVTCQFNDLISRDEAIHTSASCCIYNNYVP--EKPAITRI----HQLFSEAVEIECAFLK---SHAPK-TRLVN...VDAITQYVKFSADRLLSAINVPKLFNTPPPDSDFPLA
DSQ  ATGGATCAG---AAAGATTGCAGTCATTTTTTT------TACAGGCCGGAGTGTCCAGATATAAACAATTTACGTGCCCTGAGCATTTCGAATCGTTGGTTAGAAAGCGATTTTATCATTGAAGATGATTATCAATACTTGGACTGT---TTAACGGAAGATGAACTAATATTCTACAGATTTATTTTTACATTTTTATCGGCGGCAGATGATCTGGTAAATGTTAATTTG---GGCTCTCTAACCCAACTCTTTTCCCAAAAGGATATTCACCATTACTACATTGAACAAGAGTGCATCGAGGTTGTCCACGCGCGTGTCTATAGTCAAATTCAACTAATGTTGTTCAGAGGGGATGAATCGTTGCGGGTACAATACGTAAATGTCACTATTAATAATCCGTCGATCCAACAAAAAGTACAATGGTTGGAAGAAAAGGTACGGGACAACCCATCC---GTTGCAGAAAAATATATACTAATGATTCTTATAGAGGGCATTTTTTTTGTATCATCGTTCGCGGCTATTGCATATTTACGCAATAACGGACTATTTGTTGTAACTTGTCAATTTAACGACCTTATAAGCCGAGATGAAGCCATACATACCAGCGCATCGTGTTGTATATACAATAACTATGTACCC------GAAAAACCCGCTATCACCAGAATA------------CATCAACTGTTTTCGGAAGCCGTTGAAATCGAGTGTGCGTTTTTAAAA---------TCCCATGCACCCAAA---ACCCGTTTGGTGAAC.........GTCGATGCAATTACACAATACGTGAAATTCAGCGCGGACAGGCTTTTATCAGCGATTAATGTACCAAAACTATTTAACACCCCACCTCCCGATTCGGACTTTCCACTTGCA
TRN  10010101100011000
NAM  RIR2_EHV1B/12-295
ASQ  TAELSLAGAFF--YTPECPDIEHLRSLSVANRWLDTDLPISDDLKDVAK-LTPAEREFYRFLFAFLSAADDLVNLNL-GDLSALFTQKDILHYYIEQESIEVTHSRVYSAIQLMLFGNDAAARARYVASIIGDAAIGRKVAWLQAKVRECGS-VAEKYILMILIEGLFFASSFASIAYLRTHNLFVVTCQSNDLISRDEAIHTRASCCIYNNYLGGFEKPEPKRI----YELFSEAVNIECEFLL---SHAPQYSHLLD...IGAIISYVRYSADRLLGEIGLSPLFNAPKPSPSFPLA
DSQ  ACCGCAGAATTATCATTAGCAGGTGCGTTTTTT------TATACTCCAGAATGCCCCGATATCGAGCACCTGCGCTCGCTCAGCGTTGCAAACCGCTGGCTGGACACCGACCTTCCCATTTCCGATGACCTCAAGGACGTGGCCAAG---CTCACGCCGGCCGAGCGCGAGTTTTACCGGTTCCTGTTCGCCTTTTTATCTGCCGCCGACGACTTGGTGAATTTGAACCTG---GGCGATCTCTCAGCTCTGTTTACTCAAAAGGACATTCTCCACTACTACATAGAGCAAGAGTCTATTGAGGTTACACACTCCAGGGTATACAGCGCTATACAGCTCATGTTGTTTGGAAACGACGCAGCCGCGCGCGCTAGGTATGTAGCGTCCATCATCGGAGACGCTGCCATCGGACGGAAGGTTGCCTGGCTACAGGCAAAGGTGCGTGAATGCGGATCT---GTGGCGGAGAAGTATATTCTGATGATCCTCATCGAGGGACTCTTTTTCGCATCGTCCTTTGCGTCTATCGCCTATCTCCGTACCCACAACCTATTTGTGGTAACGTGCCAGAGCAATGATTTGATCAGCCGCGACGAGGCGATCCACACTCGCGCCTCGTGCTGCATCTACAACAACTACCTGGGGGGATTTGAGAAGCCCGAGCCCAAAAGGATT------------TATGAGCTGTTCTCCGAGGCGGTGAATATCGAGTGTGAATTTCTGCTA---------TCCCACGCTCCCCAATATAGTCACCTGTTGGAC.........ATCGGGGCCATCATCAGCTACGTACGCTATAGCGCGGATCGCCTTTTGGGTGAAATAGGACTATCCCCCCTGTTTAATGCCCCCAAACCATCCCCGAGCTTTCCTCTCGCC
TRN  10010101100011000
NAM  RIR2_BHV1C/7-288
ASQ  AATLTRKYKYF--YETECPDLDHLRSLSVANRWLETEFPLADDAKDVAR-LSGAELEFYRFLFAFLSAADDLVNVNL-GDLSELFTQKDILHYYIEQESIEVVHSRVYSAIQLLLFRNDAVARAGYVEGALGDPAVRRKVDWLERRVAAAES-VAEKYVLMILIEGIFFSSSFAAIAYLRTHNLFVVTCQTNDLISRDEAVHTAASCCIFDNYLGG-ERPPPARI----YELFREAWKLSASLF----GCAPRGSHILD...VEAISAYVEYSADRLLAAIQLPPLFGTPPPGTDFPLA
DSQ  GCGGCGACCCTCACGCGTAAATACAAATACTTT------TACGAGACCGAGTGCCCCGACCTAGATCACTTGCGGTCGCTCAGCGTCGCAAACCGCTGGCTGGAGACCGAGTTTCCCCTAGCGGACGACGCCAAGGACGTGGCGCGG---CTCAGCGGCGCCGAGCTGGAGTTTTACCGCTTTCTGTTCGCGTTCCTCTCGGCCGCCGATGACCTCGTGAACGTCAACCTC---GGGGACCTGTCCGAGCTGTTCACCCAAAAAGACATCCTGCATTACTATATCGAGCAGGAGTCCATCGAAGTGGTGCACTCGCGGGTGTACAGCGCCATACAGCTGCTGCTCTTTAGAAACGACGCGGTGGCGCGCGCGGGCTACGTAGAGGGCGCCCTCGGCGACCCGGCGGTCCGGCGCAAGGTGGACTGGCTCGAGCGGCGCGTGGCCGCGGCAGAGTCG---GTGGCCGAAAAGTACGTGCTCATGATTCTAATCGAGGGCATTTTTTTCTCCTCCTCGTTTGCGGCGATTGCCTACCTGCGCACCCACAACCTTTTCGTCGTGACGTGCCAAACCAACGACCTCATCAGCCGCGACGAAGCCGTGCACACGGCCGCGTCGTGCTGCATCTTCGACAACTACCTCGGCGGG---GAGCGGCCGCCGCCGGCCCGCATC------------TACGAGCTGTTCCGCGAAGCGTGGAAATTGAGCGCGAGTTTATTT------------GGTTGCGCGCCGCGCGGCAGTCATATACTTGAC.........GTGGAGGCTATTTCTGCGTACGTCGAGTACAGCGCGGACCGCCTGCTCGCTGCTATCCAGCTGCCTCCTCTGTTTGGCACCCCGCCTCCTGGGACCGATTTTCCTTTGGCC
TRN  10010101100011010
NAM  RIR2_HHV11/28-314
ASQ  IPKCPDPERYF--YTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSK-LSEGELSFYRFLFAFLSAADDLVTENL-GGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIRAKVDWLEARVRECAS-VPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPPPDRV----YGLFRQAVEIEIGFIR---SQAPTDSHILSpaaLAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLS
DSQ  ATTCCAAAGTGCCCCGACCCCGAGAGGTACTTC------TACACCTCCCAGTGTCCCGACATTAACCACCTGCGCTCCCTCAGCATCCTTAACCGCTGGCTGGAAACCGAGCTTGTTTTCGTGGGGGACGAGGAGGACGTCTCCAAG---CTTTCCGAGGGCGAGCTCAGCTTTTACCGCTTCCTCTTCGCTTTCCTGTCGGCCGCCGACGACCTGGTTACGGAAAACCTG---GGCGGCCTCTCCGGCCTGTTTGAGCAGAAGGACATTCTCCACTACTACGTGGAGCAGGAATGCATCGAAGTCGTACACTCGCGCGTGTACAACATCATCCAGCTGGTGCTTTTCCACAACAACGACCAGGCGCGCCGCGAGTACGTGGCCGGTACCATCAACCACCCGGCCATCCGCGCCAAGGTGGACTGGTTGGAAGCGCGGGTGCGGGAATGCGCCTCC---GTTCCGGAAAAGTTCATTCTCATGATCCTCATCGAGGGCATCTTTTTTGCCGCCTCGTTTGCCGCCATCGCCTACCTTCGCACCAACAACCTTCTGCGGGTCACCTGCCAGTCAAACGACCTCATCAGCCGGGACGAGGCCGTGCACACGACGGCCTCGTGTTACATCTACAACAACTACCTCGGCGGGCACGCCAAGCCCCCGCCCGACCGCGTG------------TACGGGCTGTTCCGCCAGGCGGTCGAGATCGAGATCGGATTTATCCGA---------TCCCAGGCGCCGACGGACAGCCATATCCTGAGCccggcggcgCTGGCGGCCATCGAAAACTACGTGCGATTCAGCGCGGATCGCCTGTTGGGCCTTATCCACATGAAGCCACTGTTTTCCGCCCCACCCCCCGACGCCAGCTTTCCGCTGAGC
TRN  10010101100011001
NAM  RIR2_SHV21/1-279
ASQ  MDSVK---KYL--YTCDHVGFLELTKETWKNRWFPSQVPLQGDVCCVDM-LNERDLEFYKFLFTFLGMAEKLVNINI-EDLLSQFDSHDISHYYAEQMAMENIHGKVYANILNMLFKNNITEVYSYACDIMNDSALQEKLRWLNGRVTEASD-KAEKILLFLLVEGIFFISSFFSIGLFRVRGIMNGICLANDYIARDEMLHTSAAALLYNTMTKSSERPSEDWI----YKLFREAVEVEFKFIA---AKGYG-VSLVN...VHEIRQFLQATADRILESINLNPIYGSLPPE-NCPLA
DSQ  ATGGACTCTGTTAAG---------AAGTACTTG------TATACTTGCGACCATGTTGGGTTTTTAGAGCTAACAAAAGAAACTTGGAAAAATCGGTGGTTTCCTAGTCAAGTTCCTCTCCAAGGAGATGTGTGTTGTGTGGATATG---TTAAATGAAAGAGATCTTGAATTTTATAAATTTTTATTTACTTTTCTTGGGATGGCAGAAAAATTAGTTAACATTAATATT---GAAGATCTTTTAAGTCAGTTTGATAGTCATGATATAAGTCATTACTATGCTGAACAAATGGCTATGGAAAACATCCATGGAAAAGTGTATGCTAACATTTTGAACATGCTGTTTAAAAATAACATTACAGAAGTCTACTCTTATGCTTGTGACATAATGAATGATAGTGCTTTGCAAGAAAAACTAAGGTGGTTGAACGGCCGCGTTACAGAAGCATCTGAT---AAAGCTGAAAAAATTTTATTGTTTTTGCTAGTTGAAGGAATCTTTTTTATTAGTTCATTTTTTAGTATTGGATTGTTTAGAGTTCGAGGAATTATGAATGGAATCTGTCTCGCAAATGATTACATTGCTAGAGATGAAATGTTGCACACATCTGCTGCTGCTCTACTATATAACACAATGACTAAGTCCTCAGAGAGGCCTTCAGAAGACTGGATT------------TATAAGTTGTTTAGAGAAGCAGTTGAAGTGGAGTTTAAATTTATAGCT---------GCAAAAGGCTATGGT---GTTTCACTTGTAAAT.........GTGCATGAAATAAGACAGTTTTTGCAAGCTACTGCTGACAGAATTTTAGAAAGTATTAATTTAAATCCAATCTATGGCTCACTTCCTCCAGAA---AATTGTCCTTTAGCA
TRN  10010101100011000
NAM  RIR2_EBV/1-276
ASQ  MS------KLL--YVRDHEGFACLTVETHRNRWFAAHIVLTKDCGCLKL-LNERDLEFYKFLFTFLAMAEKLVNFNI-DELVTSFESHDIDHYYTEQKAMENVHGETYANILNMLFDGDRAAMNAYAEAIMADEALQAKISWLRDKVAAAVT-LPEKILVFLLIEGIFFISSFYSIALLRVRGLMPGICLANNYISRDELLHTRAASLLYNSMTAKADRPRATWI----QELFRTAVEVETAFIE---ARGEG-VTLVD...VRAIKQFLEATADRILGDIGQAPLYGTPPPK-DCPLT
DSQ  ATGTCC------------------AAGTTGTTG------TACGTGCGTGATCATGAGGGCTTTGCCTGCCTAACGGTCGAAACCCACCGCAACCGCTGGTTCGCGGCTCACATTGTCCTCACCAAGGACTGCGGGTGTCTCAAGCTA---CTCAATGAGAGGGACTTGGAGTTTTACAAGTTCCTCTTTACGTTCCTGGCCATGGCCGAGAAGCTTGTGAACTTTAACATT---GATGAACTGGTCACCAGCTTCGAGAGCCACGACATTGATCACTACTACACCGAGCAGAAGGCCATGGAGAACGTCCACGGGGAGACTTATGCTAACATTTTAAACATGCTCTTTGATGGGGACAGGGCGGCGATGAACGCCTACGCAGAGGCCATCATGGCCGACGAGGCCCTGCAAGCCAAGATTTCCTGGCTCCGTGACAAGGTGGCGGCCGCCGTCACC---CTGCCGGAGAAGATTCTTGTGTTCCTGCTGATTGAAGGCATCTTCTTCATTAGCTCCTTCTACAGCATAGCCCTGCTGCGGGTCCGGGGCCTAATGCCTGGCATCTGCCTGGCCAATAACTACATAAGTAGGGATGAGCTGCTCCACACCCGCGCTGCCTCCCTGTTATACAATAGCATGACAGCCAAGGCTGACCGACCAAGGGCCACCTGGATC------------CAGGAGCTGTTTCGCACTGCGGTGGAGGTAGAGACTGCCTTCATCGAG---------GCTCGTGGAGAGGGG---GTTACCTTGGTGGAT.........GTGCGAGCCATAAAGCAGTTTCTGGAGGCCACGGCCGATCGCATCCTGGGTGACATTGGTCAGGCTCCCTTGTATGGCACACCACCCCCCAAG---GACTGCCCGCTCACC
TRN  10010101100011010
//