EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00170 - bZIP_1)
FAM  PF00170
PID  bZIP_1
DES  bZIP transcription factor
IPR  IPR011616
ANO  22
ALN  65
AID  0.321811
APH  ((((((((((CPRF1_PETCR/267-331:0.26268,TAF1_TOBAC/192-256:0.07132):0.14817,GBF2_ARATH/247-311:0.20298):0.05660,GBF3_ARATH/257-321:0.09970):0.14927,EMP1_WHEAT/248-312:0.27506):0.08230,((CPRF3_PETCR/194-258:0.38382,GBF1_ARATH/220-284:0.03881):0.15309,HBPA_WHEAT/250-314:0.26588):0.03464):0.61040,(GBF4_ARATH/185-249:1.09247,(ATF4_HUMAN/276-340:0.92746,YEN5_YEAST/382-446:0.94254):0.27194):0.32234):0.21442,((CREBA_DROME/439-503:0.87721,((CREM_HUMAN/272-332:0.10411,(ATF1_HUMAN/211-271:0.11830,CREB_BOVIN/265-325:0.05520):0.13805):0.38732,BZLF1_EBV/170-231:1.82027):0.38207):0.00000,YAP4_YEAST/235-295:1.67807):0.02246):0.40026,(CPC1_NEUCR/214-270:0.84388,GCN4_YEAST/223-280:0.19860):0.64990):0.27799,AP1_DROME/210-274:0.15346):0.21052,AP1_CHICK/229-293:0.06300,JUNB_HUMAN/266-330:0.14314);
ATP  ((((((((((CPRF1_PETCR/267-331,TAF1_TOBAC/192-256),GBF2_ARATH/247-311),GBF3_ARATH/257-321),EMP1_WHEAT/248-312),((CPRF3_PETCR/194-258,GBF1_ARATH/220-284),HBPA_WHEAT/250-314)),(GBF4_ARATH/185-249,(ATF4_HUMAN/276-340,YEN5_YEAST/382-446))),((CREBA_DROME/439-503,((CREM_HUMAN/272-332,(ATF1_HUMAN/211-271,CREB_BOVIN/265-325)),BZLF1_EBV/170-231)),YAP4_YEAST/235-295)),(CPC1_NEUCR/214-270,GCN4_YEAST/223-280)),AP1_DROME/210-274),AP1_CHICK/229-293,JUNB_HUMAN/266-330);
ATL  15.9569
DNO  21
DLN  195
DID  0.419998
DPH  (((((((ATF4_HUMAN/276-340:0.64882,((YEN5_YEAST/382-446:0.53115,YAP4_YEAST/235-295:0.77182):0.08983,(CPC1_NEUCR/214-270:0.51115,GCN4_YEAST/223-280:0.33888):0.23822):0.11611):0.10930,((AP1_DROME/210-274:0.27716,JUNB_HUMAN/266-330:0.09626):0.06858,AP1_CHICK/229-293:0.24708):0.48703):0.11128,(GBF4_ARATH/185-249:0.59181,(((((CPRF3_PETCR/194-258:0.33614,GBF1_ARATH/220-284:0.17977):0.13447,HBPA_WHEAT/250-314:0.25170):0.10993,EMP1_WHEAT/248-312:0.31141):0.14945,(CPRF1_PETCR/267-331:0.27852,GBF3_ARATH/257-321:0.14629):0.07102):0.14001,GBF2_ARATH/247-311:0.08661):0.30598):0.12916):0.13851,BZLF1_EBV/170-231:0.86570):0.09050,CREBA_DROME/439-503:0.64118):0.21953,CREM_HUMAN/272-332:0.12046):0.09161,ATF1_HUMAN/211-271:0.15656,CREB_BOVIN/265-325:0.19119);
DTP  (((((((ATF4_HUMAN/276-340,((YEN5_YEAST/382-446,YAP4_YEAST/235-295),(CPC1_NEUCR/214-270,GCN4_YEAST/223-280))),((AP1_DROME/210-274,JUNB_HUMAN/266-330),AP1_CHICK/229-293)),(GBF4_ARATH/185-249,(((((CPRF3_PETCR/194-258,GBF1_ARATH/220-284),HBPA_WHEAT/250-314),EMP1_WHEAT/248-312),(CPRF1_PETCR/267-331,GBF3_ARATH/257-321)),GBF2_ARATH/247-311))),BZLF1_EBV/170-231),CREBA_DROME/439-503),CREM_HUMAN/272-332),ATF1_HUMAN/211-271,CREB_BOVIN/265-325);
DTL  10.3802
RID  0.312866
RPH  ((((((((((GBF3_ARATH/257-321:0.10480,CPRF1_PETCR/267-331:0.34206):0.04298,GBF2_ARATH/247-311:0.22191):0.13327,EMP1_WHEAT/248-312:0.27132):0.07291,((CPRF3_PETCR/194-258:0.38428,GBF1_ARATH/220-284:0.04052):0.15778,HBPA_WHEAT/250-314:0.26645):0.04091):0.60498,(GBF4_ARATH/185-249:1.09020,(ATF4_HUMAN/276-340:0.93103,YEN5_YEAST/382-446:0.93107):0.26134):0.30864):0.24125,YAP4_YEAST/235-295:1.68561):0.00000,(CREBA_DROME/439-503:0.88132,((CREM_HUMAN/272-332:0.10542,(ATF1_HUMAN/211-271:0.11818,CREB_BOVIN/265-325:0.05516):0.13652):0.38658,BZLF1_EBV/170-231:1.82716):0.40366):0.00000):0.40098,(CPC1_NEUCR/214-270:0.84088,GCN4_YEAST/223-280:0.20181):0.64617):0.28090,AP1_DROME/210-274:0.15356):0.21056,AP1_CHICK/229-293:0.06266,JUNB_HUMAN/266-330:0.14350);
RTP  ((((((((((GBF3_ARATH/257-321,CPRF1_PETCR/267-331),GBF2_ARATH/247-311),EMP1_WHEAT/248-312),((CPRF3_PETCR/194-258,GBF1_ARATH/220-284),HBPA_WHEAT/250-314)),(GBF4_ARATH/185-249,(ATF4_HUMAN/276-340,YEN5_YEAST/382-446))),YAP4_YEAST/235-295),(CREBA_DROME/439-503,((CREM_HUMAN/272-332,(ATF1_HUMAN/211-271,CREB_BOVIN/265-325)),BZLF1_EBV/170-231))),(CPC1_NEUCR/214-270,GCN4_YEAST/223-280)),AP1_DROME/210-274),AP1_CHICK/229-293,JUNB_HUMAN/266-330);
RTL  15.7764
LNK  AP1_CHICK/229-293:P18870:M57467
LNK  AP1_DROME/210-274:P18289:X54144
LNK  ATF1_HUMAN/211-271:P18846:X55544
LNK  ATF4_HUMAN/276-340:P18848:D90209
LNK  BZLF1_EBV/170-231:P03206:V01555
LNK  CPC1_NEUCR/214-270:P11115:J03262
LNK  CPRF1_PETCR/267-331:Q99089:X58575
LNK  CPRF3_PETCR/194-258:Q99091:X58576
LNK  CREBA_DROME/439-503:P29747:X64429
LNK  CREB_BOVIN/265-325:P27925:X57031
LNK  CREM_HUMAN/272-332:Q03060:S68134
LNK  EMP1_WHEAT/248-312:P25032:M62893
LNK  GBF1_ARATH/220-284:P42774:X63894
LNK  GBF2_ARATH/247-311:P42775:X63895
LNK  GBF3_ARATH/257-321:P42776:U17891
LNK  GBF4_ARATH/185-249:P42777:U01823
LNK  GCN4_YEAST/223-280:P03069:K02205
LNK  HBPA_WHEAT/250-314:P23922:X56781
LNK  JUNB_HUMAN/266-330:P17275:M29039
LNK  TAF1_TOBAC/192-256:Q99142:
LNK  YAP4_YEAST/235-295:P40917:U16780
LNK  YEN5_YEAST/382-446:P39970:U18796
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YEN5_YEAST/382-446
ASQ  AKAWKRARLLERNRIAASKCRQRKKMSQLQLQREFDQISKENTMMKKKIENYEKLVQKMKKISRL
DSQ  GCTAAAGCTTGGAAGCGTGCAAGGCTACTAGAACGAAACAGAATTGCCGCTTCCAAGTGTCGACAGAGAAAGAAAATGTCACAATTACAACTTCAAAGGGAATTTGACCAAATAAGCAAAGAAAACACAATGATGAAGAAAAAAATTGAAAATTACGAAAAATTGGTTCAAAAAATGAAGAAAATTTCGAGGTTG
TRN  10010101110011000
NAM  ATF4_HUMAN/276-340
ASQ  EKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEE
DSQ  GAGAAACTGGATAAGAAGCTGAAAAAAATGGAGCAAAACAAGACAGCAGCCACTAGGTACCGCCAGAAGAAGAGGGCGGAGCAGGAGGCTCTTACTGGTGAGTGCAAAGAGCTGGAAAAGAAGAACGAGGCTCTAAAAGAGAGGGCGGATTCCCTGGCCAAGGAGATCCAGTACCTGAAAGATTTGATAGAAGAG
TRN  10010101100011011
NAM  TAF1_TOBAC/192-256
ASQ  ERELKREKRKQSNRESARRSRLRKQAEAEELAIRVQSLTAENMTLKSEINKLMENSEKLKLENAA
NAM  CPRF1_PETCR/267-331
ASQ  DRDLKRERRKQSNRESARRSRLRKQAEAEELAIKVDSLTAENMALKAEINRLTLTAEKLTNDNSR
DSQ  GACCGAGATCTAAAGCGAGAGAGGCGGAAGCAGTCTAATCGTGAATCTGCAAGAAGGTCGAGGCTGAGGAAACAGGCTGAGGCTGAGGAACTTGCAATTAAAGTAGACTCCTTGACTGCTGAGAACATGGCACTTAAAGCTGAAATCAACCGATTGACATTGACTGCAGAAAAACTGACAAATGATAACTCTAGA
TRN  10010101100011011
NAM  GBF3_ARATH/257-321
ASQ  ERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANAT
DSQ  GAGAGAGAACTGAAACGGGAGCGAAGGAAACAGTCTAATAGAGAATCTGCTAGAAGGTCAAGATTAAGGAAACAGGCCGAGACAGAAGAACTTGCTAGGAAAGTGGAAGCCTTGACAGCCGAAAACATGGCATTAAGATCTGAACTAAACCAACTTAATGAGAAATCTGATAAACTAAGAGGAGCAAATGCAACC
TRN  10010101100011000
NAM  GBF2_ARATH/247-311
ASQ  EKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEA
DSQ  GAAAAAGAGGTTAAACGAGAGAAGAGAAAACAGTCAAACCGAGAATCTGCTAGGAGGTCAAGACTGAGGAAGCAGGCTGAAACAGAACAACTATCTGTCAAAGTTGACGCATTAGTAGCTGAGAACATGTCTCTGAGGTCTAAACTAGGCCAGCTAAACAATGAGTCTGAGAAACTACGGCTGGAGAACGAAGCT
TRN  10010101100011000
NAM  EMP1_WHEAT/248-312
ASQ  ERELKRERRKQSNRESARRSRLRKQQECEELAQKVSELTAANGTLRSELDQLKKDCKTMETENKK
DSQ  GAACGGGAACTGAAGAGGGAGAGAAGGAAACAATCCAACAGAGAGTCTGCAAGGAGATCAAGATTACGCAAACAGCAAGAATGCGAAGAGTTAGCCCAGAAGGTAAGTGAGCTGACCGCAGCGAATGGCACGCTCAGATCAGAACTCGACCAGCTTAAGAAGGACTGCAAAACCATGGAAACAGAAAATAAAAAG
TRN  10010101100011000
NAM  HBPA_WHEAT/250-314
ASQ  ERELKKQKRKLSNRESARRSRLRKQAECEELGQRAEALKSENSSLRIELDRIKKEYEELLSKNTS
DSQ  GAAAGGGAACTGAAGAAGCAGAAGAGGAAGCTGTCCAACCGGGAATCAGCGCGCAGGTCCCGGCTGCGCAAGCAGGCTGAGTGTGAAGAGCTCGGGCAGCGCGCTGAGGCTTTGAAGTCAGAGAACTCGTCCCTCAGGATCGAGCTCGACCGGATCAAAAAGGAGTACGAGGAGCTCCTTTCGAAGAACACCTCT
TRN  10010101100011001
NAM  GBF1_ARATH/220-284
ASQ  ERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNS
DSQ  GAACGAGAGCTCAAGCGGCAGAAGAGGAAACAATCTAACCGTGAATCCGCTAGGCGGTCTAGATTGCGGAAGCAGGCCGAATGCGAACAACTTCAACAAAGAGTAGAGAGTTTGTCGAACGAGAATCAAAGCCTGAGAGATGAGCTACAGAGACTCTCAAGCGAATGTGATAAGCTCAAGTCTGAGAACAACTCA
TRN  10010101100011001
NAM  CPRF3_PETCR/194-258
ASQ  ERELKRQRRKQSNRESARRSRLRKQAKSDELQERLDNLSKENRILRKNLQRISEACAEVTSENHS
DSQ  GAGCGTGAGCTGAAAAGACAGAGAAGAAAGCAATCTAATCGGGAGTCAGCAAGGAGATCAAGACTACGCAAACAGGCTAAATCTGATGAGCTACAGGAAAGGTTAGATAATTTAAGCAAAGAAAACCGCATACTAAGAAAAAATCTGCAGAGAATCTCTGAGGCATGCGCGGAGGTTACATCTGAAAATCATTCC
TRN  10010101100011000
NAM  GBF4_ARATH/185-249
ASQ  KAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEVLI
DSQ  AAAGCTGCAGCTCAGAGACAGAAGAGGATGATCAAGAACCGTGAATCCGCTGCTAGGTCTCGAGAGAGGAAACAGGCTTATCAGGTTGAGTTAGAGACTTTGGCTGCCAAGTTAGAGGAGGAGAATGAGCAGCTTTTGAAGGAGATTGAAGAGAGCACTAAAGAGAGATACAAGAAGCTCATGGAGGTTCTGATT
TRN  10010101100011010
NAM  CREB_BOVIN/265-325
ASQ  EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC----HKSD
DSQ  GAAGCGGCGCGAAAGAGAGAGGTTCGCCTCATGAAGAACAGGGAAGCAGCACGAGAGTGTCGTAGAAAGAAGAAAGAATATGTGAAATGTCTAGAAAACAGAGTGGCAGTGCTTGAAAATCAAAACAAGACACTGATTGAGGAGCTAAAAGCACTTAAGGACCTTTACTGC------------CACAAATCAGAT
TRN  10010101100011001
NAM  ATF1_HUMAN/211-271
ASQ  DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYS----NKSV
DSQ  GACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCC------------AATAAAAGTGTT
TRN  10010101100011010
NAM  CREM_HUMAN/272-332
ASQ  EATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICS----PKTD
DSQ  GAAGCAACACGCAAACGAGAGCTGAGGCTAATGAAAAACAGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAGAATATGTAAAATGCCTGGAGAGCCGAGTTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACTTGAAACCTTGAAAGACATTTGTTCT------------CCCAAAACTGAT
TRN  10010101100011011
NAM  CREBA_DROME/439-503
ASQ  EKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHK
DSQ  GAGAAATCGCTGAAGAAGATTCGACGCAAAATCAAGAATAAAATCTCTGCTCAGGAAAGCCGCCGCAAGAAGAAGGAGTACATGGACCAGCTGGAGAGGCGCGTCGAGATCCTGGTCACCGAAAACCATGACTACAAGAAGCGCCTCGAGGGGCTGGAGGAGACCAATGCCAATCTACTTAGTCAGCTGCACAAA
TRN  10010101100011011
NAM  JUNB_HUMAN/266-330
ASQ  QERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMT
DSQ  CAAGAGCGCATCAAAGTGGAGCGCAAGCGGCTGCGGAACCGGCTGGCGGCCACCAAGTGCCGGAAGCGGAAGCTGGAGCGCATCGCGCGCCTGGAGGACAAGGTGAAGACGCTCAAGGCCGAGAACGCGGGGCTGTCGAGTACCGCCGGCCTCCTCCGGGAGCAGGTGGCCCAGCTCAAACAGAAGGTCATGACC
TRN  11011101101011011
NAM  AP1_CHICK/229-293
ASQ  QERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMN
DSQ  CAGGAGAGAATCAAAGCCGAGAGAAAACGCATGAGAAACAGAATTGCGGCGTCCAAATGCCGGAAAAGGAAGTTGGAAAGGATTGCCAGGTTGGAAGAAAAAGTGAAAACTTTGAAAGCCCAGAACTCAGAGCTGGCATCCACGGCCAACATGCTCAGAGAACAGGTTGCACAGCTTAAGCAGAAGGTCATGAAC
TRN  10010101100011001
NAM  AP1_DROME/210-274
ASQ  QEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVME
DSQ  CAGGAGAAGATCAAGCTGGAGCGCAAGAGGCAGCGTAACCGTGTGGCTGCATCCAAGTGCCGCAAGCGCAAGCTGGAGCGCATCTCAAAGCTGGAGGATCGCGTGAAGGTACTTAAGGGCGAGAACGTCGACCTGGCTAGCATCGTGAAGAACCTCAAGGACCATGTGGCGCAGCTGAAGCAGCAGGTGATGGAG
TRN  10010101100011001
NAM  GCN4_YEAST/223-280
ASQ  ESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKN-------YHLENEVARLKKLVGE
DSQ  GAATCCAGTGATCCTGCTGCTCTAAAACGTGCTAGAAACACTGAAGCCGCCAGGCGTTCTCGTGCGAGAAAGTTGCAAAGAATGAAACAACTTGAAGACAAGGTTGAAGAATTGCTTTCGAAAAAT---------------------TATCACTTGGAAAATGAGGTTGCCAGATTAAAGAAATTAGTTGGCGAA
TRN  10010101110011010
NAM  CPC1_NEUCR/214-270
ASQ  DPSDVVAMKRARNTLAARKSRERKAQRLEELEAKIEELIAER-------DRWKNLALAHGASTE-
DSQ  GATCCTTCCGATGTCGTTGCCATGAAGCGTGCTCGCAACACTTTGGCTGCTCGCAAGTCTCGTGAGCGCAAGGCTCAGCGCTTGGAGGAGTTGGAAGCTAAGATCGAGGAACTGATCGCAGAGCGT---------------------GACCGTTGGAAGAACTTGGCTTTGGCGCACGGTGCGTCTACGGAG---
TRN  11011111101111111
NAM  BZLF1_EBV/170-231
ASQ  ECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLR---LLLKQMCPSLDVDSII
DSQ  GAATGCGATTCTGAACTAGAAATAAAGCGATACAAGAATCGGGTGGCTTCCAGAAAATGCCGGGCCAAGTTTAAGCAACTGCTGCAGCACTACCGTGAGGTCGCTGCTGCCAAATCATCTGAAAATGACAGGCTGCGC---------CTCCTGTTGAAGCAGATGTGCCCAAGCCTGGATGTTGACTCCATTATC
TRN  10010101100011001
NAM  YAP4_YEAST/235-295
ASQ  GKPLRNTKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMK----ENSELKKMIESLKSKLKE
DSQ  GGCAAACCTTTAAGAAATACTAAGAGAGCTGCCCAAAATCGAAGCGCACAAAAGGCGTTTAGGCAGCGTCGTGAGAAATACATCAAAAATCTCGAAGAAAAATCAAAACTATTCGATGGCTTGATGAAA------------GAAAACAGTGAATTGAAAAAAATGATTGAATCATTAAAGTCGAAATTAAAAGAA
TRN  10010101110011000
//